Project name: 8c9d14d3a8862b2

Status: done

Started: 2026-03-11 11:03:52
Chain sequence(s) A: RVQLVESGGGLVQAGGSLRLSCAADGFDFKSYAMGWYRQAPGREDELVAAITASGDYTYYADSVKGRFTISRDNAKNTVYLQMNSLKPDDTAVYYCAALSYVAEGYWGQGTQVTVSSGGGSQVQLVESGGGSVQPGGSLTLSCTASGFPLSMWGMTWLRQAPGKGLERVSGIASDSTNTYYADSVKGRFAISRDNAKNKLFLQMNSLKPEDTAVYFCARKWTNWDLKGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8c9d14d3a8862b2/tmp/folded.pdb                (00:02:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:18)
Show buried residues

Minimal score value
-3.3788
Maximal score value
2.104
Average score
-0.7036
Total score value
-166.7535

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 R A -2.2944
2 V A -1.5609
3 Q A -1.2075
4 L A 0.0000
5 V A 0.6257
6 E A -0.0962
7 S A -0.6604
8 G A -1.3273
9 G A -0.8533
10 G A 0.0722
11 L A 0.9656
12 V A 0.0000
13 Q A -1.4316
14 A A -1.2876
15 G A -1.2579
16 G A -0.8875
17 S A -1.3367
18 L A -1.0662
19 R A -2.2816
20 L A 0.0000
21 S A -0.5730
22 C A 0.0000
23 A A -0.5225
24 A A 0.0000
25 D A -2.5539
26 G A -2.1645
27 F A -1.8772
28 D A -2.6272
29 F A 0.0000
30 K A -2.5576
31 S A -0.9179
32 Y A -0.2208
33 A A 0.3081
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A 0.2065
38 R A 0.0000
39 Q A -2.0904
40 A A 0.0000
41 P A -1.2243
42 G A -1.5581
43 R A -2.5596
44 E A -3.3788
45 D A -3.1015
46 E A -1.5210
47 L A 0.5356
48 V A 0.0000
49 A A 0.0000
50 A A 1.0477
51 I A 0.0000
52 T A -0.1002
53 A A -0.6028
54 S A -1.0756
55 G A -1.0756
56 D A -1.3090
57 Y A 0.6255
58 T A 0.8740
59 Y A 1.4503
60 Y A 0.0445
61 A A -0.7557
62 D A -2.3189
63 S A -1.6322
64 V A 0.0000
65 K A -2.4366
66 G A -1.7799
67 R A -1.6491
68 F A 0.0000
69 T A -0.7988
70 I A 0.0000
71 S A -0.4984
72 R A -1.0586
73 D A -1.5343
74 N A -2.0586
75 A A -1.4573
76 K A -2.2963
77 N A -2.3369
78 T A -1.2653
79 V A 0.0000
80 Y A -0.6821
81 L A 0.0000
82 Q A -1.6429
83 M A 0.0000
84 N A -1.5079
85 S A -1.1853
86 L A 0.0000
87 K A -1.5453
88 P A 0.0000
89 D A -1.0583
90 D A 0.0000
91 T A -0.4617
92 A A 0.0000
93 V A -0.5754
94 Y A 0.0000
95 Y A 0.2480
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 L A 1.1783
100 S A 0.9312
101 Y A 2.0763
102 V A 2.1040
103 A A 0.7950
104 E A -0.4787
105 G A 0.0762
106 Y A 0.4466
107 W A 1.1368
108 G A 0.2417
109 Q A -0.7309
110 G A -0.5012
111 T A -0.7807
112 Q A -1.0313
113 V A 0.0000
114 T A -0.1101
115 V A 0.0000
116 S A 0.0000
117 S A -1.2432
118 G A -1.0474
119 G A -1.2079
120 G A -1.2421
121 S A -0.9956
122 Q A -1.3447
123 V A -0.2812
124 Q A -0.5721
125 L A 0.0000
126 V A 0.5708
127 E A -0.2911
128 S A -0.4635
129 G A -0.6693
130 G A -0.8194
131 G A -0.6845
132 S A -0.7168
133 V A -0.8862
134 Q A -1.7622
135 P A -1.8900
136 G A -1.4655
137 G A -1.1658
138 S A -0.8979
139 L A -0.2762
140 T A -0.2688
141 L A 0.0000
142 S A -0.0672
143 C A 0.0000
144 T A -0.1969
145 A A 0.0000
146 S A -0.4009
147 G A -0.5461
148 F A 0.0000
149 P A 0.0000
150 L A 0.0000
151 S A -1.0753
152 M A -0.6382
153 W A -0.3400
154 G A -0.5875
155 M A 0.0000
156 T A 0.0000
157 W A 0.0000
158 L A 0.0000
159 R A 0.0000
160 Q A -1.1848
161 A A -1.4482
162 P A -1.1241
163 G A -1.4971
164 K A -2.3161
165 G A -1.4174
166 L A -0.3913
167 E A -1.2183
168 R A -0.6439
169 V A 0.0000
170 S A 0.0000
171 G A 0.0000
172 I A 0.0000
173 A A -1.1043
174 S A -1.2746
175 D A -2.2395
176 S A -1.6852
177 T A -1.3701
178 N A -1.6145
179 T A -0.4252
180 Y A -0.1206
181 Y A -0.6667
182 A A 0.0000
183 D A -2.3603
184 S A -1.7147
185 V A 0.0000
186 K A -2.5052
187 G A -1.7288
188 R A -1.3281
189 F A 0.0000
190 A A -0.4601
191 I A 0.0000
192 S A -0.3695
193 R A -1.0848
194 D A -1.4949
195 N A -1.6190
196 A A -1.4163
197 K A -2.1161
198 N A 0.0000
199 K A -1.1397
200 L A 0.0000
201 F A 0.0157
202 L A 0.0000
203 Q A -0.4274
204 M A 0.0000
205 N A -1.2157
206 S A -1.3353
207 L A 0.0000
208 K A -2.5909
209 P A -2.1020
210 E A -2.4424
211 D A 0.0000
212 T A -1.1875
213 A A 0.0000
214 V A -0.1951
215 Y A 0.0000
216 F A 0.0000
217 C A 0.0000
218 A A 0.0000
219 R A -1.1403
220 K A -1.0525
221 W A -0.1265
222 T A -0.8867
223 N A -1.6051
224 W A -1.4188
225 D A -2.1904
226 L A -1.3167
227 K A -1.5746
228 G A -0.8593
229 Q A -1.2281
230 G A -0.8822
231 T A -0.7734
232 Q A -1.2575
233 V A 0.0000
234 T A -1.0041
235 V A 0.0000
236 S A -1.1909
237 S A -0.8742
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.523 3.6426 View CSV PDB
4.5 -0.5801 3.6395 View CSV PDB
5.0 -0.6414 3.635 View CSV PDB
5.5 -0.6985 3.6297 View CSV PDB
6.0 -0.7422 3.6246 View CSV PDB
6.5 -0.7662 3.6204 View CSV PDB
7.0 -0.7716 3.6178 View CSV PDB
7.5 -0.764 3.6165 View CSV PDB
8.0 -0.7465 3.6161 View CSV PDB
8.5 -0.719 3.6158 View CSV PDB
9.0 -0.6816 3.6155 View CSV PDB