Project name: fold_rfa148_b3v_a5v_b39s_fv84b_b27vq [mutate: QY32A]

Status: done

Started: 2026-06-24 08:07:30
Chain sequence(s) A: EVQLAESGGGLEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSS
B: DIAMTQSPLSLPVTPGEPASISCRSSQETSAIGWYLQKPGQSPQLLIYGTSTRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTGVPGTFGQGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues QY32A
Energy difference between WT (input) and mutated protein (by FoldX) -1.9002 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:00:57)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:06)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8caf09aeb1aefc8/tmp/folded.pdb                (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:58)
Show buried residues

Minimal score value
-3.0494
Maximal score value
1.4987
Average score
-0.7888
Total score value
-183.0058

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9307
2 V A -0.8333
3 Q A -1.4960
4 L A 0.0000
5 A A -0.5720
6 E A 0.0000
7 S A -0.8014
8 G A -0.9903
9 G A -0.5062
10 G A 0.0931
11 L A 0.9005
12 E A -0.6447
13 Q A -1.5881
14 P A -1.7889
15 G A -1.4026
16 G A -1.0661
17 S A -1.3589
18 L A -1.0960
19 R A -1.9967
20 L A 0.0000
21 S A -0.6430
22 C A 0.0000
23 A A -0.7023
24 G A 0.0000
25 S A -0.9863
26 G A -1.0797
27 F A -0.3840
28 T A -0.1546
29 F A 0.0000
30 S A -1.1222
31 S A -0.4573
32 Y A -0.4504 mutated: QY32A
33 G A -0.6133
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8576
40 A A -1.2476
41 P A -1.0105
42 G A -1.4477
43 K A -2.3650
44 G A -1.5641
45 L A 0.0000
46 E A -1.0723
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.4236
51 I A 0.0000
52 S A -0.6854
53 A A -1.0839
54 D A -2.1470
55 G A -1.3715
56 S A -0.9035
57 G A -0.4188
58 T A 0.2836
59 Y A 0.8639
60 Y A -0.2103
61 A A 0.0000
62 D A -2.4004
63 S A -1.7420
64 V A 0.0000
65 K A -2.5014
66 G A -1.7497
67 R A -1.5256
68 F A 0.0000
69 T A -0.7475
70 I A 0.0000
71 S A -0.4657
72 R A -1.2916
73 D A -1.8490
74 N A -2.0277
75 S A -1.6546
76 K A -2.4305
77 N A -1.8239
78 T A -1.2365
79 L A 0.0000
80 Y A -0.5520
81 L A 0.0000
82 Q A -1.2940
83 M A 0.0000
84 N A -1.4059
85 S A -1.1596
86 L A 0.0000
87 R A -2.2184
88 A A -1.7239
89 E A -2.1946
90 D A 0.0000
91 T A -0.7127
92 A A 0.0000
93 V A -0.0277
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.2870
99 L A 0.0000
100 S A -0.8306
101 R A -2.4637
102 V A 0.0000
103 R A -2.7404
104 V A -1.0168
105 G A -1.0662
106 S A -1.0983
107 T A -1.7505
108 R A -2.8613
109 G A 0.0000
110 V A -0.9783
111 V A 0.0000
112 G A 0.0000
113 D A -0.6356
114 V A -0.2425
115 W A -0.4944
116 G A 0.0000
117 Q A -1.6037
118 G A 0.0000
119 T A -0.4355
120 T A -0.0633
121 V A 0.0000
122 T A -0.2032
123 V A 0.0000
124 S A -0.8469
125 S A -0.7446
1 D B -1.4878
2 I B -1.0192
3 A B -1.0041
4 M B 0.0000
5 T B -0.9535
6 Q B 0.0000
7 S B -0.2202
8 P B 0.2215
9 L B 0.9694
10 S B 0.0835
11 L B -0.2642
12 P B -1.2812
13 V B 0.0000
14 T B -1.9661
15 P B -1.9587
16 G B -1.9108
17 E B -2.3743
18 P B -2.1140
19 A B 0.0000
20 S B -0.6837
21 I B 0.0000
22 S B -0.8919
23 C B 0.0000
24 R B -2.8627
25 S B 0.0000
26 S B -1.8995
27 Q B -2.7544
28 E B -2.8994
29 T B 0.0000
30 S B -1.4770
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -1.1881
38 K B -1.8722
39 P B -1.1619
40 G B -1.5392
41 Q B -2.2071
42 S B -1.4721
43 P B 0.0000
44 Q B -1.2763
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.3755
49 G B -0.8418
50 T B 0.0000
51 S B -0.6296
52 T B -0.9326
53 R B -2.2575
54 G B 0.0000
55 S B -0.9491
56 G B -1.0986
57 V B 0.0000
58 P B -1.5234
59 D B -2.4198
60 R B -2.1131
61 F B 0.0000
62 S B -1.4006
63 G B 0.0000
64 S B -0.7037
65 G B -1.1383
66 S B -1.2603
67 G B -1.8285
68 T B -2.3840
69 D B -2.5592
70 F B 0.0000
71 T B -1.0309
72 L B 0.0000
73 K B -1.4087
74 I B 0.0000
75 S B -2.2530
76 R B -3.0494
77 V B 0.0000
78 E B -2.3599
79 A B -1.3876
80 E B -2.1222
81 D B 0.0000
82 V B -0.9719
83 G B 0.0000
84 V B -0.3458
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.1121
91 T B -0.9089
92 G B -0.1740
93 V B 1.4987
94 P B 0.4941
95 G B 0.3279
96 T B -0.2545
97 F B -0.2749
98 G B 0.0000
99 Q B -1.2716
100 G B 0.0000
101 T B 0.0000
102 K B -0.7581
103 L B 0.0000
104 E B -1.7031
105 I B -1.8863
106 K B -2.8067
107 R B -2.7829
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.83 1.9973 View CSV PDB
4.5 -0.8744 1.9244 View CSV PDB
5.0 -0.9283 1.8348 View CSV PDB
5.5 -0.9835 1.7379 View CSV PDB
6.0 -1.0307 1.6386 View CSV PDB
6.5 -1.0623 1.5385 View CSV PDB
7.0 -1.0765 1.4383 View CSV PDB
7.5 -1.0777 1.3389 View CSV PDB
8.0 -1.0705 1.3284 View CSV PDB
8.5 -1.0567 1.4461 View CSV PDB
9.0 -1.0365 1.6024 View CSV PDB