Project name: AAAV_R5

Status: done

Started: 2026-08-21 08:49:48
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8d76325cd1d685f/tmp/folded.pdb                (00:02:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:54)
Show buried residues

Minimal score value
-2.7441
Maximal score value
1.9412
Average score
-0.5613
Total score value
-139.1906

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5917
2 V A -1.2776
3 Q A -1.9505
4 L A 0.0000
5 Q A -1.8491
6 E A 0.0000
7 S A -0.7067
8 G A -0.4635
9 P A -0.1287
10 G A 0.1354
11 L A 0.5268
12 V A 0.0000
13 K A -1.6834
14 P A -1.2879
15 S A -1.3777
16 Q A -1.9093
17 T A -1.5873
18 L A 0.0000
19 S A -0.9834
20 L A 0.0000
21 T A -0.6865
22 A A 0.0000
23 T A -1.2401
24 V A 0.0000
25 S A -1.3041
26 G A -1.3131
27 G A -1.0154
28 S A -0.6610
29 I A 0.0000
30 S A -0.3487
31 S A -0.3582
32 G A -0.1674
33 D A -0.1086
34 Y A 0.5197
35 Y A 0.5348
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6952
43 P A -0.7217
44 G A -1.1368
45 C A -1.2471
46 K A -2.0303
47 G A -1.2198
48 L A 0.0000
49 E A -0.7381
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1119
54 I A 0.0000
55 Y A 0.1793
56 Y A 0.0820
57 S A -0.2327
58 G A -0.3276
59 S A -0.3179
60 T A -0.2981
61 D A -0.7334
62 Y A -0.7207
63 N A -0.8943
64 P A -1.2859
65 S A -1.2513
66 L A 0.0000
67 K A -2.0882
68 S A -1.4080
69 R A -1.6538
70 V A 0.0000
71 T A -1.0978
72 M A 0.0000
73 S A -0.4228
74 V A -0.4324
75 D A -1.2479
76 T A -1.1052
77 S A -1.3534
78 K A -2.1788
79 N A -1.4724
80 Q A -1.2922
81 F A 0.0000
82 S A -0.5510
83 L A 0.0000
84 K A -1.5989
85 V A 0.0000
86 N A -1.7524
87 S A -1.5065
88 V A 0.0000
89 T A -0.7114
90 A A -0.3894
91 A A -0.3212
92 D A 0.0000
93 T A 0.2341
94 A A 0.0000
95 V A 0.2232
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7296
103 I A 1.4061
104 F A 1.9412
105 G A 0.8940
106 V A 0.8255
107 G A 0.7751
108 T A 0.0000
109 F A 0.0000
110 D A -0.4926
111 Y A -0.5795
112 W A -0.8450
113 G A 0.0000
114 Q A -1.6662
115 G A -0.7712
116 T A -0.1864
117 L A 0.7812
118 V A 0.0000
119 T A 0.2119
120 V A 0.0000
121 S A -0.3726
122 S A -0.7435
123 A A -0.6301
124 A A -0.3639
125 G A -0.8402
126 G A -1.0853
127 G A -1.1529
128 G A -1.2024
129 S A -1.0126
130 G A -1.1696
131 G A -1.1881
132 G A -1.1770
133 G A -1.2299
134 S A -1.0893
135 G A -1.2640
136 G A -1.3380
137 G A -1.2623
138 G A -1.2318
139 S A -0.8488
140 D A -0.8287
141 I A 0.0000
142 V A 0.9581
143 M A 0.0000
144 T A -0.6316
145 Q A -0.6519
146 S A -0.7174
147 P A -0.3542
148 A A -0.3861
149 T A -0.5242
150 L A -0.2319
151 S A -0.3805
152 L A -0.6786
153 S A -0.9994
154 P A -1.4625
155 G A -1.8380
156 E A -2.4369
157 R A -2.7441
158 A A 0.0000
159 T A -0.6457
160 L A 0.0000
161 S A -0.9253
162 A A 0.0000
163 R A -2.4633
164 A A 0.0000
165 S A -0.9279
166 Q A -1.6351
167 S A -1.3281
168 V A 0.0000
169 S A -0.5245
170 S A -0.2156
171 Y A 0.6606
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3891
179 P A -0.9062
180 G A -1.0313
181 C A -1.1845
182 Q A -1.6848
183 A A -1.2596
184 P A 0.0000
185 R A -1.6259
186 L A -0.7472
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2166
190 D A -0.3353
191 A A 0.0000
192 S A -0.8756
193 N A -1.2430
194 R A -1.4610
195 A A -0.9461
196 T A -0.6039
197 G A -0.6626
198 I A 0.0000
199 P A -0.4407
200 A A -0.4097
201 R A -0.7883
202 F A 0.0000
203 S A -0.7064
204 G A 0.0000
205 S A -0.8032
206 G A -1.1824
207 S A -1.0064
208 G A -1.1449
209 T A -1.8949
210 D A -2.4591
211 F A 0.0000
212 T A -0.8191
213 L A 0.0000
214 T A -0.6218
215 I A 0.0000
216 S A -1.5124
217 S A -1.8351
218 L A 0.0000
219 E A -2.1700
220 P A -1.3384
221 E A -2.0368
222 D A 0.0000
223 F A -0.6471
224 A A 0.0000
225 V A -0.6759
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1221
233 S A -0.2853
234 T A -0.4057
235 P A -0.4728
236 L A 0.0000
237 T A 0.1416
238 F A 0.2285
239 G A 0.0000
240 G A -0.8202
241 G A -0.8016
242 T A 0.0000
243 K A -0.9276
244 A A 0.0000
245 E A -0.5092
246 I A 0.6778
247 K A -0.8982
248 A A -0.3518
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5278 4.8426 View CSV PDB
4.5 -0.5482 4.8388 View CSV PDB
5.0 -0.5716 4.8284 View CSV PDB
5.5 -0.5928 4.8058 View CSV PDB
6.0 -0.6053 4.7691 View CSV PDB
6.5 -0.6045 4.7232 View CSV PDB
7.0 -0.591 4.6732 View CSV PDB
7.5 -0.5692 4.6217 View CSV PDB
8.0 -0.5427 4.5698 View CSV PDB
8.5 -0.5128 4.5178 View CSV PDB
9.0 -0.4801 4.4661 View CSV PDB