Project name: 8d931d11c629457

Status: done

Started: 2026-03-10 19:13:29
Chain sequence(s) A: MDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSIGGGGSGGGGSFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8d931d11c629457/tmp/folded.pdb                (00:05:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:34)
Show buried residues

Minimal score value
-5.4572
Maximal score value
3.6787
Average score
-0.9787
Total score value
-319.0556

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2879
2 D A -1.2124
3 D A -2.6761
4 R A -2.4254
5 F A -0.4431
6 N A -2.1441
7 D A -1.8030
8 V A 0.4520
9 N A -0.6614
10 T A -0.4676
11 I A 0.4566
12 N A -1.8560
13 K A -2.7369
14 K A -2.6830
15 Q A -1.9911
16 F A 0.2379
17 T A -1.0313
18 E A -2.1346
19 E A -2.4018
20 E A -1.1177
21 F A 0.4017
22 S A -1.2142
23 R A -2.2381
24 L A -0.5808
25 I A -0.6061
26 N A -1.9082
27 S A -1.4160
28 M A -1.1457
29 L A -1.4590
30 K A -2.7090
31 E A -3.4289
32 Y A -2.3329
33 I A -2.1267
34 E A -4.4562
35 D A -5.2044
36 N A -4.9980
37 K A -5.3613
38 K A -5.4572
39 D A -5.4498
40 K A -4.6965
41 H A -3.4810
42 P A -2.3281
43 T A -1.9858
44 Q A -2.2867
45 K A -2.4358
46 T A -1.5468
47 T A -1.3051
48 P A -1.4303
49 K A -2.0009
50 P A -1.2394
51 T A -0.9788
52 T A -1.0473
53 P A -1.2098
54 K A -2.0577
55 Q A -1.6669
56 I A -0.2061
57 N A -1.8003
58 D A -2.3110
59 G A -1.6994
60 T A -1.6391
61 S A -1.9559
62 D A -2.8462
63 K A -2.9773
64 T A -1.9877
65 S A -1.9768
66 D A -2.4717
67 T A -1.2880
68 H A -1.3021
69 T A -0.5566
70 I A 0.3458
71 K A -1.7933
72 R A -2.2086
73 T A -1.4811
74 T A -1.3938
75 P A -1.4384
76 K A -2.0009
77 P A -1.2389
78 T A -0.9652
79 T A -1.0467
80 P A -1.2061
81 K A -2.0370
82 Q A -1.6704
83 I A -0.2124
84 N A -1.7843
85 D A -2.3334
86 G A -1.7127
87 T A -1.6953
88 S A -2.0154
89 D A -2.8352
90 K A -2.9687
91 T A -1.9750
92 S A -1.9373
93 D A -2.4395
94 T A -1.2583
95 H A -1.1996
96 T A -0.5360
97 I A 0.3392
98 K A -1.7895
99 R A -2.2241
100 T A -1.4892
101 T A -1.4029
102 P A -1.4331
103 K A -1.9960
104 P A -1.2411
105 T A -0.9887
106 T A -1.0912
107 P A -1.2267
108 K A -2.0434
109 Q A -1.7043
110 I A -0.2535
111 N A -1.8123
112 D A -2.3174
113 G A -1.7322
114 T A -1.6677
115 S A -2.4099
116 D A -3.1044
117 K A -3.2775
118 P A -2.2078
119 K A -2.3542
120 S A -0.3806
121 I A 1.8766
122 A A 1.5123
123 D A 0.6605
124 I A 2.1652
125 F A 3.0583
126 L A 2.8241
127 I A 2.2285
128 N A -0.7690
129 K A -1.5412
130 P A -1.4622
131 K A -1.6438
132 V A 1.2575
133 P A 1.2238
134 L A 2.1489
135 W A 3.2596
136 I A 3.6787
137 V A 3.3916
138 N A 1.9945
139 P A 2.2657
140 L A 2.6405
141 Y A 2.2791
142 Y A 2.3582
143 M A 1.9011
144 V A 1.6144
145 E A 0.6556
146 K A 0.4999
147 F A 1.6123
148 V A 1.2247
149 Q A 1.3474
150 I A 2.1498
151 M A 1.7597
152 G A 1.3102
153 Y A 1.8581
154 L A 1.2254
155 L A 0.5021
156 E A -1.8286
157 D A -2.8150
158 D A -3.4070
159 D A -3.0129
160 T A -1.2470
161 L A -0.0957
162 E A -0.7240
163 L A 0.9387
164 N A -0.5110
165 L A 0.6423
166 P A 0.0412
167 K A -0.3591
168 Y A 1.4273
169 Y A 1.2920
170 Y A 1.0203
171 D A -0.9727
172 K A -1.7030
173 S A -0.7199
174 I A 0.5950
175 G A -0.6381
176 G A -0.7425
177 G A -0.9074
178 G A -1.0344
179 S A -1.1367
180 G A -1.1741
181 G A -1.2186
182 G A -1.0941
183 G A -1.2607
184 S A -0.9927
185 F A -1.1305
186 D A -2.3529
187 A A 0.0000
188 S A -2.1932
189 N A -2.4580
190 F A 0.0000
191 K A -2.2913
192 D A -1.3561
193 F A 0.0000
194 S A -0.8335
195 S A -1.1354
196 I A 0.0000
197 A A -0.5964
198 S A -0.8584
199 A A -0.7320
200 S A -0.6698
201 S A 0.0000
202 S A -0.2005
203 W A 0.0000
204 Q A -1.0872
205 N A 0.0000
206 Q A -1.7530
207 S A -1.1989
208 G A -1.0904
209 S A 0.0000
210 T A -0.7546
211 M A 0.0000
212 I A -0.1210
213 I A 0.0000
214 Q A -1.6358
215 V A 0.0000
216 D A -0.9336
217 S A 0.2375
218 F A 1.1072
219 G A -0.5925
220 N A -1.1303
221 V A 0.0000
222 S A -1.2930
223 G A -0.8761
224 Q A -0.9020
225 Y A 0.0000
226 V A 0.0000
227 N A 0.0000
228 R A -2.0371
229 A A -1.6344
230 Q A -1.8076
231 G A -1.3306
232 T A -1.0604
233 G A -1.4496
234 C A 0.0000
235 Q A -2.1627
236 N A -1.9611
237 S A -1.4488
238 P A -1.0637
239 Y A 0.0000
240 P A -0.9307
241 L A 0.0000
242 T A -0.9976
243 G A -1.1794
244 R A -1.9187
245 V A -0.9187
246 N A -1.0803
247 G A -0.9739
248 T A -0.1172
249 F A 0.9209
250 I A 0.0000
251 A A -0.3683
252 F A 0.0000
253 S A -0.6422
254 V A 0.0000
255 G A -1.1143
256 W A 0.0000
257 N A -2.7068
258 N A -1.8278
259 S A -1.2600
260 T A -1.5691
261 E A -2.6361
262 N A -2.9097
263 C A -1.9001
264 N A -2.3035
265 S A -1.0384
266 A A -0.3433
267 T A 0.0000
268 G A -0.6320
269 W A 0.0000
270 T A -0.0914
271 G A 0.0000
272 Y A 1.1427
273 A A 0.0000
274 Q A -0.6493
275 V A -1.3423
276 N A -1.8577
277 G A -1.6868
278 N A -2.2731
279 N A -1.8611
280 T A 0.0000
281 E A -0.8562
282 I A 0.0000
283 V A 0.2601
284 T A 0.0000
285 S A -0.8965
286 W A -1.0618
287 N A -1.3013
288 L A -0.2792
289 A A -0.1979
290 Y A -0.6834
291 E A -1.9250
292 G A -1.0951
293 G A -1.0909
294 S A -0.9097
295 G A -1.0754
296 P A -0.7340
297 A A -0.0508
298 I A 0.8088
299 E A -0.8590
300 Q A -1.8693
301 G A -1.7369
302 Q A -1.7122
303 D A 0.0000
304 T A -0.7628
305 F A 0.0000
306 Q A -1.3100
307 Y A 0.0000
308 V A 0.2504
309 P A -0.5068
310 T A -0.7350
311 T A -1.5566
312 E A -3.0205
313 N A -2.8391
314 K A -2.4880
315 S A -0.8976
316 L A 0.8360
317 L A 0.7165
318 K A -1.7615
319 D A -2.5854
320 T A -2.0618
321 H A -2.7413
322 H A -2.6906
323 H A -2.6633
324 H A -2.6809
325 H A -2.3819
326 H A -1.8823
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4713 6.3646 View CSV PDB
4.5 -0.5568 6.3646 View CSV PDB
5.0 -0.6548 6.3646 View CSV PDB
5.5 -0.743 6.3646 View CSV PDB
6.0 -0.7988 6.3646 View CSV PDB
6.5 -0.8127 6.3646 View CSV PDB
7.0 -0.7932 6.3646 View CSV PDB
7.5 -0.7545 6.3645 View CSV PDB
8.0 -0.7038 6.3644 View CSV PDB
8.5 -0.6407 6.3641 View CSV PDB
9.0 -0.5625 6.3629 View CSV PDB