Project name: PT_mut_5

Status: done

Started: 2026-05-11 02:51:03
Chain sequence(s) A: EVKLVESGGDLVKPGGSLKLSCAASGFTFSAYAHSWVRQNPEKRLEWVASISKGGNTYYPNSVKGRFTISRDNARNILYLQMSSLRSEDTALYYCARGWGNYGWFAYWGQVTLVTVSA
B: DIKMTQSPSSMYASLGERVTITCKASQDINRYLNWFQQKPGKSPKTLIYRANRLLSGVPSRFSGSGSGQDYSLTISSLDYEDMGIYYCLQYDEYPLTFGDGTKLELK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:05)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:32:26)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:32:27)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:32:28)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:32:29)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:32:30)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:32:31)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:32:31)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:32:32)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:32:33)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:32:34)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:32:35)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:32:35)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:32:36)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:32:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:32:41)
Show buried residues

Minimal score value
-2.9314
Maximal score value
1.7166
Average score
-0.6857
Total score value
-154.2745

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9983
2 V A 0.0000
3 K A -1.5754
4 L A 0.0000
5 V A -0.0634
6 E A 0.0000
7 S A -0.2772
8 G A -0.0263
9 G A 0.1630
10 D A 0.2070
11 L A 0.9841
12 V A 0.0000
13 K A -1.5984
14 P A -1.2300
15 G A -1.1761
16 G A -0.8135
17 S A -1.0775
18 L A -1.0011
19 K A -1.7202
20 L A 0.0000
21 S A -0.3074
22 C A 0.0000
23 A A -0.1468
24 A A 0.0000
25 S A -0.4092
26 G A -0.3186
27 F A 0.6719
28 T A -0.1973
29 F A 0.0000
30 S A -0.6688
31 A A -0.1934
32 Y A -0.0152
33 A A -0.3651
34 H A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -1.0956
40 N A 0.0000
41 P A -1.5793
42 E A -2.5507
43 K A -2.9001
44 R A -2.4663
45 L A 0.0000
46 E A 0.0000
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -1.2921
53 K A -2.4707
54 G A -1.7052
55 G A -1.4770
56 N A -1.2283
57 T A -0.0636
58 Y A 1.2909
59 Y A 1.1215
60 P A -0.0217
61 N A -1.1677
62 S A -0.6569
63 V A -1.0591
64 K A -2.3958
65 G A -2.2493
66 R A -2.5352
67 F A 0.0000
68 T A -0.3041
69 I A 0.1714
70 S A -0.9489
71 R A -2.0308
72 D A -2.9314
73 N A -2.8101
74 A A -1.8636
75 R A -2.5644
76 N A -1.7010
77 I A -1.1132
78 L A 0.0000
79 Y A -0.4547
80 L A 0.0000
81 Q A -1.2512
82 M A 0.0000
83 S A -1.8094
84 S A -1.4924
85 L A 0.0000
86 R A 0.0000
87 S A -1.3083
88 E A -1.9533
89 D A 0.0000
90 T A -0.0547
91 A A 0.0000
92 L A 0.3924
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 R A 0.1452
98 G A 0.0000
99 W A 0.2038
100 G A -1.0311
101 N A -1.7649
102 Y A 0.0000
103 G A 0.0000
104 W A 0.0000
105 F A 0.0000
106 A A 0.0000
107 Y A 0.2023
108 W A -0.6244
109 G A -1.0668
110 Q A -1.2772
111 V A 0.0226
112 T A 0.0000
113 L A 1.7166
114 V A 0.0000
115 T A 0.5064
116 V A -0.0057
117 S A -0.6352
118 A A -0.7593
1 D B -2.5380
2 I B 0.0000
3 K B -2.4745
4 M B -1.2383
5 T B -1.0273
6 Q B -0.8657
7 S B -0.7290
8 P B -0.5117
9 S B -0.6307
10 S B -0.7351
11 M B 0.0000
12 Y B 0.3693
13 A B 0.0000
14 S B -0.7833
15 L B -0.0668
16 G B -1.2211
17 E B -2.6694
18 R B -2.2104
19 V B 0.0000
20 T B -0.2984
21 I B 0.0000
22 T B -0.6276
23 C B 0.0000
24 K B -2.1770
25 A B -1.6645
26 S B -1.7395
27 Q B -1.5425
28 D B -1.3301
29 I B 0.6133
30 N B 0.0000
31 R B -2.5336
32 Y B 0.0000
33 L B 0.0000
34 N B 0.0000
35 W B 0.0000
36 F B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.6136
40 P B -1.4325
41 G B -1.1536
42 K B -2.2230
43 S B 0.0000
44 P B 0.0000
45 K B -0.5764
46 T B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -1.5531
50 R B -2.3582
51 A B -1.8005
52 N B -1.9916
53 R B -1.9131
54 L B -0.2394
55 L B 0.0971
56 S B -0.0848
57 G B -0.1813
58 V B 0.0333
59 P B 0.0000
60 S B -0.8984
61 R B -1.5432
62 F B -0.3190
63 S B -0.3020
64 G B -0.6671
65 S B -0.9832
66 G B -1.3742
67 S B -1.3078
68 G B -1.1582
69 Q B -1.9876
70 D B -1.9713
71 Y B 0.0000
72 S B -0.7700
73 L B 0.0000
74 T B -0.4873
75 I B 0.0000
76 S B 0.0000
77 S B -1.6849
78 L B 0.0000
79 D B -2.0573
80 Y B -1.2153
81 E B -2.2365
82 D B -1.2529
83 M B 0.0000
84 G B -1.4089
85 I B 0.0000
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 L B 0.0000
90 Q B 0.0000
91 Y B 0.0000
92 D B -2.3181
93 E B -2.6556
94 Y B -1.3714
95 P B -1.0001
96 L B 0.0000
97 T B -1.3643
98 F B 0.0000
99 G B -1.1157
100 D B 0.0000
101 G B -1.2430
102 T B 0.0000
103 K B -1.8627
104 L B 0.0000
105 E B -1.3048
106 L B -1.1115
107 K B -1.6288
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.6857 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_2 -0.6857 View CSV PDB
model_7 -0.7192 View CSV PDB
model_11 -0.7286 View CSV PDB
model_9 -0.7291 View CSV PDB
model_4 -0.7347 View CSV PDB
model_10 -0.7389 View CSV PDB
model_1 -0.7421 View CSV PDB
CABS_average -0.7446 View CSV PDB
input -0.7447 View CSV PDB
model_3 -0.7465 View CSV PDB
model_0 -0.7668 View CSV PDB
model_6 -0.7672 View CSV PDB
model_8 -0.7841 View CSV PDB
model_5 -0.7921 View CSV PDB