Project name: 8e674661d99c2c

Status: done

Started: 2026-05-18 02:45:23
Chain sequence(s) A: MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAELEAPSAGYIPPPAAAPSATYLPVNKVK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8e674661d99c2c/tmp/folded.pdb                 (00:03:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:37)
Show buried residues

Minimal score value
-5.1288
Maximal score value
4.4883
Average score
-0.8179
Total score value
-231.4793

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5875
2 R A -0.5297
3 G A 0.8823
4 F A 3.0373
5 I A 3.2237
6 I A 3.9302
7 F A 4.4883
8 A A 3.6988
9 V A 4.4590
10 L A 3.7848
11 A A 2.4215
12 V A 2.2887
13 A A 0.3249
14 R A -1.5423
15 A A -1.0505
16 D A -1.7581
17 V A 0.4686
18 G A -0.1776
19 G A -0.2284
20 Y A 0.4848
21 N A -0.9039
22 Y A -0.2536
23 G A -0.6020
24 A A -0.6846
25 G A -0.6850
26 I A -0.3892
27 G A -0.7760
28 S A -0.9206
29 G A -0.9479
30 G A -0.6595
31 S A -0.5358
32 I A 0.0000
33 S A -0.3999
34 G A -0.4304
35 G A -0.3340
36 S A -0.6891
37 L A 0.0000
38 S A -0.8517
39 G A -0.7389
40 G A -0.7571
41 S A -0.7343
42 I A 0.0000
43 S A -0.9344
44 G A -0.9497
45 G A -0.8106
46 S A -0.6295
47 I A 0.0000
48 S A -0.7344
49 G A -0.6368
50 G A -0.6069
51 S A -0.6033
52 I A 0.0000
53 S A -0.5730
54 G A -0.6418
55 G A -0.6913
56 S A -0.5449
57 I A 0.0000
58 S A -0.8065
59 G A -1.0428
60 G A -0.7417
61 S A -0.3751
62 I A 0.0000
63 S A -0.4800
64 G A -0.5997
65 G A 0.0000
66 S A -0.1781
67 L A 0.0305
68 S A -0.3751
69 S A -0.5001
70 G A -0.5054
71 S A -0.3343
72 L A -0.0524
73 S A -0.5894
74 G A -0.8622
75 G A -0.6538
76 S A -0.2631
77 Y A 0.2427
78 S A -0.2251
79 T A -0.2864
80 N A -0.7664
81 Y A 0.7510
82 A A 0.4022
83 P A 0.2537
84 V A 1.0068
85 N A -0.8773
86 T A -0.8703
87 E A -1.9484
88 F A -1.2959
89 N A -1.8892
90 K A 0.0000
91 E A -0.3692
92 F A 0.0000
93 F A 0.0000
94 T A -0.3461
95 Y A 0.0971
96 S A -0.0821
97 A A 0.0000
98 P A -0.7877
99 E A -2.2530
100 A A -1.5299
101 D A -1.9088
102 F A -0.7031
103 E A -2.8079
104 D A -3.6494
105 N A -3.0967
106 K A -3.0584
107 S A -1.3308
108 V A 0.1280
109 S A -0.5133
110 D A -1.1956
111 L A 0.6858
112 A A 0.0276
113 A A -0.2629
114 T A -0.2570
115 L A -0.6389
116 K A -2.4871
117 K A -2.9360
118 N A -2.0052
119 L A -1.0606
120 R A 0.0000
121 V A 0.0000
122 V A 0.0000
123 F A 0.0000
124 I A 0.0000
125 R A -0.6848
126 A A 0.0000
127 P A -2.2260
128 E A -3.5127
129 N A -3.3706
130 K A -2.8112
131 G A -1.8231
132 L A 0.0000
133 E A -1.1327
134 N A -0.7552
135 A A 0.0000
136 A A 0.0000
137 L A -0.4742
138 A A 0.0000
139 L A -0.2985
140 A A 0.0000
141 K A -1.7764
142 Q A -1.5763
143 A A 0.0000
144 A A -2.0713
145 E A -2.8825
146 Q A 0.0000
147 Q A -2.3866
148 T A 0.0000
149 A A 0.0000
150 I A 0.0000
151 Y A 0.0000
152 V A 0.0000
153 L A 0.0000
154 T A -2.2281
155 K A -3.2700
156 Q A -2.9729
157 G A -2.6824
158 D A -2.3049
159 L A -1.2460
160 S A -1.2071
161 S A -1.2897
162 L A 0.0000
163 A A -1.5295
164 N A -2.4309
165 Q A -2.2919
166 L A 0.0000
167 Q A -2.5907
168 N A -2.2389
169 L A -1.2793
170 N A -1.8377
171 H A -1.0006
172 V A 0.6085
173 S A -0.3834
174 A A -0.5970
175 S A -1.7917
176 K A -2.7689
177 P A 0.0000
178 E A -2.1249
179 V A -0.8008
180 H A -0.4647
181 F A 0.0545
182 V A -0.6259
183 K A -2.5576
184 Y A 0.0000
185 R A -3.1768
186 T A -2.4928
187 Q A -2.3742
188 Q A -2.3576
189 D A -2.4988
190 A A 0.0000
191 I A -1.2664
192 N A -2.2661
193 A A -1.6433
194 Q A -1.5645
195 R A -2.8538
196 T A -2.2395
197 I A -1.9708
198 Q A -2.8462
199 Q A -3.4971
200 E A -3.4658
201 Y A -2.1258
202 E A -3.1163
203 R A -3.0018
204 L A -1.3387
205 G A -1.7517
206 G A -1.6620
207 A A -0.8669
208 S A -0.7823
209 T A -0.2977
210 S A -0.3771
211 Y A -0.2502
212 N A -0.9753
213 G A -0.3903
214 G A 0.1557
215 V A 1.1211
216 A A 0.6710
217 P A -0.4176
218 V A -0.3061
219 L A -0.6571
220 D A -1.2657
221 F A -0.3094
222 A A -0.5498
223 T A -1.1992
224 K A -2.0957
225 V A -1.0854
226 Q A -2.8441
227 Q A -3.9173
228 Q A -3.9006
229 Q A -4.4508
230 E A -5.1288
231 Q A -4.8955
232 Q A -4.7076
233 Q A -4.8211
234 Q A -4.5162
235 Q A -3.6546
236 Q A -3.5166
237 Q A -3.0022
238 Q A -2.4219
239 Q A -1.3659
240 V A 0.4388
241 Q A -0.4696
242 L A 1.1559
243 I A 1.0072
244 D A -2.0933
245 E A -3.4705
246 R A -3.8667
247 R A -3.7023
248 P A -2.0140
249 S A -1.2064
250 S A -0.9259
251 G A -0.3790
252 S A 0.4313
253 V A 1.4660
254 S A 0.2305
255 A A -0.3843
256 E A -1.4552
257 L A -0.1991
258 E A -1.4361
259 A A -0.7145
260 P A -0.7174
261 S A -0.3912
262 A A -0.0597
263 G A 0.6389
264 Y A 1.9954
265 I A 2.3350
266 P A 0.8482
267 P A -0.0002
268 P A -0.1739
269 A A -0.1349
270 A A -0.0265
271 A A -0.1041
272 P A -0.2977
273 S A -0.1811
274 A A 0.2979
275 T A 0.8798
276 Y A 2.1762
277 L A 2.3415
278 P A 1.2846
279 V A 1.2666
280 N A -0.8291
281 K A -1.4306
282 V A -0.0046
283 K A -1.4101
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.455 8.3731 View CSV PDB
4.5 -0.5111 8.3731 View CSV PDB
5.0 -0.584 8.3731 View CSV PDB
5.5 -0.6594 8.3731 View CSV PDB
6.0 -0.7219 8.3731 View CSV PDB
6.5 -0.7608 8.3731 View CSV PDB
7.0 -0.7735 8.3731 View CSV PDB
7.5 -0.7656 8.3731 View CSV PDB
8.0 -0.7455 8.3731 View CSV PDB
8.5 -0.7174 8.3731 View CSV PDB
9.0 -0.6825 8.3731 View CSV PDB