Project name: VAAV_R4

Status: done

Started: 2026-08-21 03:19:56
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:46)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/8ec670cada4b344/tmp/folded.pdb                (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:49)
Show buried residues

Minimal score value
-2.6897
Maximal score value
1.8759
Average score
-0.5279
Total score value
-130.9158

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4812
2 V A -0.9912
3 Q A -1.5079
4 L A 0.0000
5 Q A -1.7470
6 E A 0.0000
7 S A -0.6891
8 G A -0.3900
9 P A 0.0270
10 G A 0.3834
11 L A 0.9719
12 V A 0.0000
13 K A -1.8303
14 P A -1.3666
15 S A -1.4884
16 Q A -2.0825
17 T A -1.6875
18 L A 0.0000
19 S A -0.8908
20 L A 0.0000
21 T A -0.5405
22 V A 0.0000
23 T A -1.1618
24 V A 0.0000
25 S A -1.1809
26 G A -1.2340
27 G A -0.9591
28 S A -0.7172
29 I A 0.0000
30 S A -0.2750
31 S A -0.3319
32 G A -0.1352
33 D A -0.1138
34 Y A 0.5316
35 Y A 0.6197
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6772
43 P A -0.6438
44 G A -1.1086
45 C A -1.2109
46 K A -2.0371
47 G A -1.2659
48 L A 0.0000
49 E A -0.7162
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.2427
54 I A 0.0000
55 Y A 0.4166
56 Y A 0.2990
57 S A -0.1223
58 G A -0.2209
59 S A -0.2265
60 T A -0.1841
61 D A -0.6027
62 Y A -0.6289
63 N A -0.8472
64 P A -1.2523
65 S A -1.1538
66 L A 0.0000
67 K A -2.0903
68 S A -1.4909
69 R A -1.7379
70 V A 0.0000
71 T A -0.9533
72 M A 0.0000
73 S A -0.1866
74 V A -0.3130
75 D A -1.1652
76 T A -1.0323
77 S A -1.3233
78 K A -2.1675
79 N A -1.4409
80 Q A -1.2428
81 F A 0.0000
82 S A -0.3745
83 L A 0.0000
84 K A -1.1533
85 V A 0.0000
86 N A -2.0306
87 S A -1.6388
88 V A 0.0000
89 T A -0.7180
90 A A -0.3491
91 A A -0.1389
92 D A 0.0000
93 T A 0.3041
94 A A 0.0000
95 V A 0.2731
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.6482
103 I A 1.3587
104 F A 1.8759
105 G A 0.7115
106 V A 0.5284
107 G A 0.5430
108 T A 0.0000
109 F A 0.0000
110 D A -0.6386
111 Y A -0.3102
112 W A -0.6227
113 G A 0.0000
114 Q A -1.5239
115 G A -0.7087
116 T A -0.1685
117 L A 0.8721
118 V A 0.0000
119 T A 0.3613
120 V A 0.0000
121 S A -0.3745
122 S A -0.6380
123 A A -0.6250
124 A A -0.3525
125 G A -0.8377
126 G A -1.0760
127 G A -1.1212
128 G A -1.1696
129 S A -1.0300
130 G A -1.1474
131 G A -1.2250
132 G A -1.1917
133 G A -1.2432
134 S A -1.0761
135 G A -1.2210
136 G A -1.3641
137 G A -1.2296
138 G A -1.2164
139 S A -0.8481
140 D A -0.7891
141 I A -0.0079
142 V A 1.0588
143 M A 0.0000
144 T A -0.6035
145 Q A -0.6806
146 S A -0.7428
147 P A -0.3396
148 A A -0.3507
149 T A -0.4659
150 L A -0.1996
151 S A -0.3495
152 L A -0.6724
153 S A -1.0048
154 P A -1.5086
155 G A -1.8196
156 E A -2.4053
157 R A -2.6897
158 A A 0.0000
159 T A -0.6642
160 L A 0.0000
161 S A -0.8983
162 A A 0.0000
163 R A -2.3491
164 A A 0.0000
165 S A -0.8036
166 Q A -1.4496
167 S A -1.1622
168 V A 0.0000
169 S A -0.4367
170 S A -0.1955
171 Y A 0.8106
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5158
179 P A -1.0733
180 G A -0.9561
181 C A -1.0831
182 Q A -1.4351
183 A A -1.0651
184 P A 0.0000
185 R A -1.3821
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4142
190 D A -0.6021
191 A A 0.0000
192 S A -1.1405
193 N A -1.7384
194 R A -1.6170
195 A A 0.0000
196 T A -0.6029
197 G A -0.5630
198 I A -0.5094
199 P A -0.3630
200 A A -0.3392
201 R A -0.7040
202 F A 0.0000
203 S A -0.7277
204 G A 0.0000
205 S A -0.8618
206 G A -1.1307
207 S A -0.9492
208 G A -1.0340
209 T A -1.7448
210 D A -2.2081
211 F A 0.0000
212 T A -0.7829
213 L A 0.0000
214 T A -0.5920
215 I A 0.0000
216 S A -1.3562
217 S A -1.7487
218 L A 0.0000
219 E A -2.3139
220 P A -1.5075
221 E A -2.3709
222 D A 0.0000
223 F A -0.7478
224 A A 0.0000
225 V A -0.6505
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3866
232 G A 0.1056
233 S A -0.1441
234 T A -0.2970
235 P A -0.3506
236 L A 0.1362
237 T A 0.2738
238 F A 0.2897
239 G A 0.0000
240 G A -0.8333
241 G A -0.7888
242 T A 0.0000
243 K A -0.8402
244 A A 0.0000
245 E A -0.4895
246 I A 0.6858
247 K A -0.9045
248 A A -0.3561
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4681 4.7853 View CSV PDB
4.5 -0.4899 4.7703 View CSV PDB
5.0 -0.5154 4.7403 View CSV PDB
5.5 -0.5388 4.696 View CSV PDB
6.0 -0.5536 4.6436 View CSV PDB
6.5 -0.5549 4.5879 View CSV PDB
7.0 -0.5435 4.5311 View CSV PDB
7.5 -0.5238 4.4739 View CSV PDB
8.0 -0.4993 4.4169 View CSV PDB
8.5 -0.4714 4.3604 View CSV PDB
9.0 -0.4405 4.3057 View CSV PDB