Project name: 8f692e6f1096278

Chain sequence(s)	A: MAEVEYRCFVGGLAWATTDQTLGEAFSQFGEILDSKIINDRETGRSRGFGFVTFKDEKAMRDAIEGMNGQDLDGRNITVNEAQSRGSGGGGGGGGYRGGSGGGYGGGGRREGGYGGGGGYGGGRREGGYGGGGGGGYGGGRREGGYGGGSEGNWRS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
pH calculations	No
alphaCutter usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.169
• Maximal score value: 0.8462
• Average score: -1.5083
• Total score value: -235.2992

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan4D score	mutation
1	M	A	0.8462
2	A	A	-0.0346
3	E	A	-0.8523
4	V	A	0.4648
5	E	A	-0.8168
6	Y	A	-1.5762
7	R	A	-1.4540
8	C	A	0.0000
9	F	A	-0.4689
10	V	A	0.0000
11	G	A	0.0000
12	G	A	-1.5216
13	L	A	0.0000
14	A	A	0.0000
15	W	A	-0.0448
16	A	A	0.0740
17	T	A	0.0000
18	T	A	-1.4454
19	D	A	-2.9232
20	Q	A	-2.6640
21	T	A	-1.7563
22	L	A	0.0000
23	G	A	-2.4270
24	E	A	-2.6226
25	A	A	-1.4795
26	F	A	0.0000
27	S	A	-1.6039
28	Q	A	-1.8594
29	F	A	-1.6514
30	G	A	-2.0310
31	E	A	-2.4242
32	I	A	-1.2956
33	L	A	-0.2548
34	D	A	-1.8503
35	S	A	-2.0411
36	K	A	-2.3821
37	I	A	-1.3432
38	I	A	-1.5433
39	N	A	-3.3028
40	D	A	-3.7566
41	R	A	-3.9513
42	E	A	-3.4777
43	T	A	-2.8615
44	G	A	-3.2285
45	R	A	-3.4185
46	S	A	-2.2332
47	R	A	-2.7324
48	G	A	-0.9903
49	F	A	-0.1847
50	G	A	0.0000
51	F	A	-0.4749
52	V	A	0.0000
53	T	A	0.0000
54	F	A	0.0000
55	K	A	-2.8981
56	D	A	-3.4018
57	E	A	-3.1781
58	K	A	-3.6032
59	A	A	0.0000
60	M	A	0.0000
61	R	A	-4.1690
62	D	A	-3.2429
63	A	A	0.0000
64	I	A	-2.8276
65	E	A	-3.2803
66	G	A	-2.0684
67	M	A	-2.2928
68	N	A	-2.9410
69	G	A	-2.6162
70	Q	A	-3.3344
71	D	A	-3.7366
72	L	A	-2.5342
73	D	A	-2.6740
74	G	A	-2.4833
75	R	A	-2.7199
76	N	A	-3.3424
77	I	A	0.0000
78	T	A	-1.5609
79	V	A	0.0000
80	N	A	-2.7329
81	E	A	-2.7933
82	A	A	0.0000
83	Q	A	-2.6553
84	S	A	-2.1444
85	R	A	-2.5512
86	G	A	-1.8081
87	S	A	-1.4471
88	G	A	-1.4932
89	G	A	-1.2300
90	G	A	-1.3055
91	G	A	-1.1250
92	G	A	-1.1602
93	G	A	-1.2263
94	G	A	-0.8979
95	G	A	-0.6635
96	Y	A	-0.0996
97	R	A	-1.6859
98	G	A	-1.3932
99	G	A	-1.1788
100	S	A	-0.9214
101	G	A	-1.0430
102	G	A	-0.8353
103	G	A	-0.3351
104	Y	A	0.6221
105	G	A	-0.1903
106	G	A	-0.7367
107	G	A	-1.4341
108	G	A	-2.1661
109	R	A	-3.4789
110	R	A	-3.9301
111	E	A	-3.4741
112	G	A	-1.7562
113	G	A	-0.7977
114	Y	A	0.6392
115	G	A	-0.1516
116	G	A	-0.7828
117	G	A	-1.1571
118	G	A	-0.7464
119	G	A	-0.2350
120	Y	A	0.6415
121	G	A	-0.4843
122	G	A	-1.0254
123	G	A	-2.1060
124	R	A	-3.5278
125	R	A	-3.9668
126	E	A	-3.5816
127	G	A	-1.7057
128	G	A	-0.5333
129	Y	A	0.6303
130	G	A	-0.1582
131	G	A	-0.7466
132	G	A	-1.1821
133	G	A	-1.2077
134	G	A	-1.0041
135	G	A	-0.8510
136	G	A	-0.4125
137	Y	A	0.5096
138	G	A	-0.5286
139	G	A	-1.2415
140	G	A	-2.3076
141	R	A	-3.6630
142	R	A	-4.0675
143	E	A	-3.5465
144	G	A	-2.0320
145	G	A	-0.9392
146	Y	A	0.4080
147	G	A	-0.4067
148	G	A	-0.9967
149	G	A	-1.1839
150	S	A	-1.6372
151	E	A	-2.6076
152	G	A	-1.7215
153	N	A	-1.7965
154	W	A	-0.5072
155	R	A	-1.6668
156	S	A	-1.1435