Project name: FORALUMAB ANTIBODY

Status: done

Started: 2026-03-17 07:26:08
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPLTFGGGTKVEIKGGGGSGGGGSGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFKFSGYGMHWVRQAPGKGLEWVAVIWYDGSKKYYVDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQMGYWHFDLWGRGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:04)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:19)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:20)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:20)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/906b73689247170/tmp/folded.pdb                (00:04:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:40)
Show buried residues

Minimal score value
-2.6138
Maximal score value
1.7143
Average score
-0.6826
Total score value
-164.5164

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7891
2 I A 0.0000
3 V A 0.7118
4 L A 0.0000
5 T A -0.5697
6 Q A 0.0000
7 S A -0.6763
8 P A -0.3302
9 A A -0.3539
10 T A -0.4555
11 L A -0.2870
12 S A -0.7027
13 L A -1.0179
14 S A -1.3641
15 P A -1.5997
16 G A -1.7646
17 E A -2.3573
18 R A -2.5694
19 A A 0.0000
20 T A -0.6559
21 L A 0.0000
22 S A -0.8662
23 C A 0.0000
24 R A -2.3448
25 A A 0.0000
26 S A -1.0578
27 Q A -1.8936
28 S A -1.4309
29 V A 0.0000
30 S A -0.5203
31 S A -0.2893
32 Y A 0.4039
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.7242
40 P A -1.2659
41 G A -1.5096
42 Q A -2.3799
43 A A -1.6525
44 P A 0.0000
45 R A -1.6615
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A -0.1206
50 D A -0.2801
51 A A 0.0000
52 S A -0.9162
53 N A -1.2788
54 R A -1.3417
55 A A 0.0000
56 T A -0.6622
57 G A -0.6400
58 I A 0.0000
59 P A -0.4081
60 A A -0.3491
61 R A -0.7091
62 F A 0.0000
63 S A -0.6172
64 G A 0.0000
65 S A -0.7770
66 G A -1.1054
67 S A -0.9927
68 G A -1.1101
69 T A -1.7726
70 D A -2.2082
71 F A 0.0000
72 T A -0.7656
73 L A 0.0000
74 T A -0.5903
75 I A 0.0000
76 S A -1.3523
77 S A -1.7131
78 L A 0.0000
79 E A -1.9707
80 P A -1.6300
81 E A -2.3952
82 D A 0.0000
83 F A -0.7075
84 A A 0.0000
85 V A -0.2780
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -0.0769
92 S A -0.9012
93 N A -1.7163
94 W A -0.8351
95 P A -0.8185
96 P A -1.0178
97 L A 0.0000
98 T A -0.2242
99 F A 0.1257
100 G A 0.0000
101 G A -0.7524
102 G A -0.6995
103 T A 0.0000
104 K A -1.0226
105 V A 0.0000
106 E A -0.8743
107 I A -0.6386
108 K A -1.8029
109 G A -1.4444
110 G A -1.2483
111 G A -1.2212
112 G A -1.2479
113 S A -0.9653
114 G A -1.2943
115 G A -1.6052
116 G A -1.4906
117 G A -1.7895
118 S A -1.0578
119 G A -1.3257
120 G A -1.1961
121 G A -1.2542
122 G A -1.3344
123 S A -1.2830
124 Q A -1.6080
125 V A -0.9626
126 Q A -0.9874
127 L A 0.0000
128 V A 0.2486
129 E A 0.0000
130 S A -0.4721
131 G A -0.8166
132 G A 0.0944
133 G A 0.7175
134 V A 1.7143
135 V A -0.1142
136 Q A -1.3716
137 P A -1.8193
138 G A -2.0549
139 R A -2.6138
140 S A -2.0237
141 L A -1.2572
142 R A -2.1435
143 L A 0.0000
144 S A -0.5189
145 C A 0.0000
146 A A -0.2509
147 A A 0.0000
148 S A -1.0915
149 G A -1.2249
150 F A -1.0770
151 K A -1.8734
152 F A 0.0000
153 S A -1.1321
154 G A -0.7089
155 Y A 0.0712
156 G A 0.1745
157 M A 0.0000
158 H A 0.0000
159 W A 0.0000
160 V A 0.0000
161 R A 0.0000
162 Q A -0.6970
163 A A -1.0873
164 P A -0.8577
165 G A -1.4764
166 K A -2.2831
167 G A -1.3762
168 L A 0.0000
169 E A -1.0604
170 W A 0.0000
171 V A 0.0000
172 A A 0.0000
173 V A 0.0000
174 I A 0.0000
175 W A -0.0844
176 Y A 0.3417
177 D A -1.2298
178 G A -1.0548
179 S A -1.0854
180 K A -1.4818
181 K A -1.1144
182 Y A -0.6560
183 Y A -0.9417
184 V A 0.0000
185 D A -2.4384
186 S A -1.6976
187 V A 0.0000
188 K A -2.5179
189 G A -1.7204
190 R A -1.4765
191 F A 0.0000
192 T A -0.9076
193 I A 0.0000
194 S A -0.5310
195 R A -0.8837
196 D A -1.6082
197 N A -1.9056
198 S A -1.5535
199 K A -2.3620
200 N A -2.0169
201 T A -1.0438
202 L A 0.0000
203 Y A -0.5481
204 L A 0.0000
205 Q A -1.2539
206 M A 0.0000
207 N A -1.9261
208 S A -1.7292
209 L A 0.0000
210 R A -2.3208
211 A A -1.5803
212 E A -2.1745
213 D A 0.0000
214 T A -0.3588
215 A A 0.0000
216 V A 0.5254
217 Y A 0.0000
218 Y A 0.0000
219 C A 0.0000
220 A A 0.0000
221 R A -0.2293
222 Q A 0.0000
223 M A 0.4085
224 G A 0.2836
225 Y A 1.3074
226 W A 0.6947
227 H A 0.0000
228 F A 0.0000
229 D A -0.7283
230 L A -0.4038
231 W A 0.0000
232 G A 0.0000
233 R A -1.8693
234 G A 0.0000
235 T A 0.2479
236 L A 1.2860
237 V A 0.0000
238 T A 0.4493
239 V A 0.0000
240 S A -0.4937
241 S A -0.5149
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.684 1.8116 View CSV PDB
4.5 -0.7145 1.7978 View CSV PDB
5.0 -0.7485 1.7837 View CSV PDB
5.5 -0.7801 1.7694 View CSV PDB
6.0 -0.8021 1.755 View CSV PDB
6.5 -0.8092 1.7407 View CSV PDB
7.0 -0.8019 1.7265 View CSV PDB
7.5 -0.7842 1.7126 View CSV PDB
8.0 -0.7592 1.699 View CSV PDB
8.5 -0.7281 1.6837 View CSV PDB
9.0 -0.6928 1.7807 View CSV PDB