Project name: 928b33a6a95fc88

Status: done

Started: 2026-02-19 18:15:42
Chain sequence(s) C: EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYYMGWVRQAPGKGLEWVSGISPSSGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYYYGYYYSHMDYWGQGTLVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRSGLHTFGQGTKLEIK
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/928b33a6a95fc88/tmp/folded.pdb                (00:02:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:25)
Show buried residues

Minimal score value
-2.7615
Maximal score value
2.082
Average score
-0.4811
Total score value
-109.7021

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
3 E C -1.9779
4 V C -1.0578
5 Q C -0.9540
6 L C 0.0000
7 L C 0.3789
8 E C 0.0000
9 S C -0.6002
10 G C -1.0503
11 G C -0.2931
12 G C 0.3167
13 L C 1.3647
14 V C 0.2638
15 Q C -1.4831
16 P C -1.8762
17 G C -1.5432
18 G C -0.9963
19 S C -1.1231
20 L C -1.0522
21 R C -2.1376
22 L C 0.0000
23 S C -0.3842
24 C C 0.0000
25 A C -0.1552
26 A C -0.5416
27 S C -0.9496
28 G C -1.2174
29 F C -0.3606
30 T C 0.1604
31 F C 0.0000
32 S C -0.1065
33 Y C 1.5423
34 Y C 0.0000
35 Y C 0.8775
36 M C 0.0000
37 G C 0.0000
38 W C 0.0000
39 V C 0.0000
40 R C 0.0000
41 Q C -0.7991
42 A C 0.0000
43 P C -1.0307
44 G C -1.4893
45 K C -2.3465
46 G C -1.5295
47 L C 0.0000
48 E C 0.0000
49 W C 0.0000
50 V C 0.0000
51 S C 0.0000
52 G C 0.0000
53 I C 0.0000
54 S C 0.0000
55 P C 0.1074
56 S C -0.2866
57 S C -0.3384
58 G C 0.0017
59 Y C 0.9655
60 T C 0.4655
61 Y C 0.0000
62 Y C -0.8770
63 A C 0.0000
64 D C -2.6183
65 S C -1.8594
66 V C 0.0000
67 K C -2.6123
68 G C -1.7896
69 R C -1.5555
70 F C 0.0000
71 T C -0.8056
72 I C 0.0000
73 S C -0.3493
74 R C -1.1795
75 D C -2.0476
76 N C -1.8759
77 S C -1.8089
78 K C -2.5600
79 N C -1.9384
80 T C 0.0000
81 L C 0.0000
82 Y C -0.4656
83 L C 0.0000
84 Q C -1.1535
85 M C 0.0000
86 N C -1.4623
87 S C -1.3843
88 L C 0.0000
89 R C -2.7615
90 A C -2.2071
91 E C -2.6865
92 D C -1.7591
93 T C -0.2687
94 A C 0.0000
95 V C 0.5285
96 Y C 0.0000
97 Y C 0.0000
98 C C 0.0000
99 A C 0.0000
100 R C 0.0000
101 Y C 0.0000
102 Y C 1.9387
103 Y C 2.0820
104 G C 1.2779
105 Y C 0.0000
106 Y C 1.3063
107 Y C 1.6302
108 S C 0.0000
109 H C 0.0000
110 M C 0.0000
111 D C 0.2511
112 Y C 0.0928
113 W C -0.3510
114 G C 0.0000
115 Q C -1.4233
116 G C -0.5358
117 T C 0.1610
118 L C 1.0408
119 V C 0.0000
120 T C -0.2352
121 V C 0.0000
122 S C 0.0000
123 S C -1.6269
139 D C -2.3045
140 I C -1.2420
141 Q C -1.4906
142 M C 0.0000
143 T C -0.8438
144 Q C 0.0000
145 S C -0.6827
146 P C -0.4709
147 S C -0.7305
148 S C -1.0264
149 L C -0.5793
150 S C -0.8306
151 A C 0.0000
152 S C -0.3322
153 V C 0.3543
154 G C -0.7618
155 D C -1.5803
156 R C -2.2395
157 V C 0.0000
158 T C -0.5840
159 I C 0.0000
160 T C -0.7100
161 C C 0.0000
162 R C -2.1045
163 A C 0.0000
164 S C -1.4678
165 Q C -1.8103
166 S C -1.3443
167 I C 0.0000
168 S C -0.5705
169 S C -0.3127
170 Y C 0.4031
171 L C 0.0000
172 N C 0.0000
173 W C 0.0000
174 Y C 0.0000
175 Q C 0.0000
176 Q C 0.0000
177 K C -1.6155
178 P C -1.1907
179 G C -1.6802
180 K C -2.5541
181 A C -1.5373
182 P C 0.0000
183 K C -1.4315
184 L C 0.0000
185 L C 0.0000
186 I C 0.0000
187 Y C 0.4867
188 A C 0.3476
189 A C 0.0000
190 S C -0.1664
191 S C 0.1100
192 L C 0.2967
193 Q C -0.2555
194 S C -0.4229
195 G C -0.7011
196 V C 0.0000
197 P C -0.3849
198 S C -0.4047
199 R C -0.6993
200 F C 0.0000
201 S C -0.3770
202 G C -0.3373
203 S C -0.6805
204 G C -0.8694
205 S C -0.9839
206 G C -1.1401
207 T C -1.6836
208 D C -2.1715
209 F C 0.0000
210 T C -0.7004
211 L C 0.0000
212 T C -0.6215
213 I C 0.0000
214 S C -1.2285
215 S C -1.1339
216 L C 0.0000
217 Q C -0.9221
218 P C -0.6773
219 E C -1.8956
220 D C 0.0000
221 F C -0.5497
222 A C 0.0000
223 T C -0.8822
224 Y C 0.0000
225 Y C 0.0000
226 C C 0.0000
227 Q C 0.0000
228 Q C 0.0000
229 S C 0.0000
230 R C -0.2291
231 S C -0.1350
232 G C 0.1797
233 L C -0.2283
234 H C 0.0000
235 T C 0.0000
236 F C 0.0000
237 G C 0.0000
238 Q C -1.3976
239 G C 0.0000
240 T C 0.0000
241 K C -1.4971
242 L C 0.0000
243 E C -1.0589
244 I C 0.6217
245 K C -0.9135
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5416 2.3686 View CSV PDB
4.5 -0.5711 2.3626 View CSV PDB
5.0 -0.6063 2.3564 View CSV PDB
5.5 -0.6408 2.3502 View CSV PDB
6.0 -0.6669 2.344 View CSV PDB
6.5 -0.6798 2.3379 View CSV PDB
7.0 -0.6798 2.3319 View CSV PDB
7.5 -0.6704 2.3264 View CSV PDB
8.0 -0.6547 2.3217 View CSV PDB
8.5 -0.6341 2.3172 View CSV PDB
9.0 -0.6085 2.3093 View CSV PDB