Project name: 933df6589483083

Status: done

Started: 2026-06-05 12:55:44
Chain sequence(s) A: SAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:07:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/933df6589483083/tmp/folded.pdb                (00:07:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:14)
Show buried residues

Minimal score value
-3.9
Maximal score value
1.4938
Average score
-1.5014
Total score value
-373.8491

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -1.4659
2 A A -1.8977
3 K A -2.6309
4 D A -3.4389
5 Q A -3.2225
6 L A 0.0000
7 K A -3.5518
8 Q A -3.4056
9 R A -3.2403
10 V A 0.0000
11 Q A -3.3413
12 K A -3.7630
13 L A 0.0000
14 Q A -2.6612
15 E A -3.9000
16 K A -3.5964
17 V A 0.0000
18 S A -2.3283
19 Q A -2.9403
20 Q A -2.7861
21 I A 0.0000
22 A A -1.3576
23 Q A -1.9544
24 D A 0.0000
25 P A -1.1392
26 N A -1.5595
27 L A 0.0000
28 S A -0.5586
29 A A -0.3222
30 Q A -0.6240
31 Q A -0.2863
32 R A -0.2769
33 F A 1.3042
34 L A 1.4938
35 L A 0.6671
36 S A 0.0742
37 H A -0.2698
38 A A -0.4298
39 V A 0.0000
40 Y A -0.3678
41 E A -2.4643
42 D A -2.7355
43 I A 0.0000
44 S A -1.9773
45 H A -2.6324
46 V A -1.7832
47 Q A -2.4364
48 D A -2.5866
49 T A -1.2127
50 I A 0.0000
51 S A -1.4582
52 T A -0.7461
53 L A -0.7854
54 D A -1.8329
55 P A -1.4966
56 S A -1.0865
57 A A -1.1182
58 A A 0.0000
59 N A -1.8776
60 Q A -2.0681
61 V A -1.2321
62 V A 0.0000
63 D A -2.8761
64 Q A -2.7849
65 A A -2.2965
66 A A -2.2000
67 Q A -2.6144
68 Q A -2.7432
69 L A 0.0000
70 Q A -2.4352
71 D A -2.4887
72 A A -1.7599
73 L A 0.0000
74 K A -2.9156
75 Q A -2.5724
76 V A -1.5711
77 S A -1.9891
78 A A -2.0320
79 Q A -2.3127
80 N A -2.1605
81 K A -2.5258
82 P A -1.7588
83 A A -1.8635
84 S A -1.5870
85 A A -1.7070
86 K A -2.4083
87 D A -3.0334
88 Q A -2.7280
89 L A 0.0000
90 K A -3.2677
91 Q A -3.1625
92 R A -2.9744
93 V A 0.0000
94 Q A -3.2056
95 K A -3.7186
96 L A 0.0000
97 Q A 0.0000
98 E A -3.8594
99 K A -3.6327
100 V A 0.0000
101 S A -2.2467
102 Q A -2.8219
103 Q A -2.4617
104 I A 0.0000
105 A A -1.2566
106 Q A -1.8247
107 D A 0.0000
108 P A -1.0523
109 N A -1.4439
110 L A 0.0000
111 S A -0.5190
112 A A -0.2701
113 Q A -0.6030
114 Q A -0.2369
115 R A -0.1764
116 F A 1.3655
117 L A 1.4827
118 L A 0.6832
119 S A 0.2714
120 H A -0.2323
121 A A -0.3935
122 V A 0.0000
123 Y A -0.3341
124 E A -2.4181
125 D A -2.7484
126 I A 0.0000
127 S A -1.9636
128 H A -2.6741
129 V A 0.0000
130 Q A -2.4490
131 D A -2.6159
132 T A -1.2669
133 I A 0.0000
134 S A -1.4467
135 T A -0.7301
136 L A -0.7851
137 D A -1.7964
138 P A -1.4376
139 S A -1.0801
140 A A -1.1134
141 A A 0.0000
142 N A -1.8799
143 Q A -2.0622
144 V A -1.1658
145 V A 0.0000
146 D A -2.9089
147 Q A -2.8334
148 A A -2.3663
149 A A -2.2682
150 Q A -2.8160
151 Q A -2.9271
152 L A 0.0000
153 Q A -2.1937
154 D A -2.4211
155 A A -1.7137
156 L A 0.0000
157 K A -2.8148
158 Q A -2.5231
159 V A -1.5057
160 S A -1.9297
161 A A -1.9982
162 Q A -2.2836
163 N A -2.1156
164 K A -2.4858
165 P A -1.6501
166 A A -1.7465
167 S A -1.4186
168 A A -1.5913
169 K A -2.3011
170 D A -2.5721
171 Q A -2.6046
172 L A 0.0000
173 K A -3.6200
174 Q A -3.2668
175 R A -3.1792
176 V A 0.0000
177 Q A -3.3368
178 K A -3.7659
179 L A 0.0000
180 Q A -2.6259
181 E A -3.8131
182 K A -3.4255
183 V A 0.0000
184 S A -2.2818
185 Q A -2.8871
186 Q A -2.7518
187 I A 0.0000
188 A A -1.3193
189 Q A -1.9603
190 D A 0.0000
191 P A -1.1443
192 N A -1.5536
193 L A 0.0000
194 S A -0.5597
195 A A -0.3037
196 Q A -0.5957
197 Q A -0.2493
198 R A -0.2283
199 F A 1.3844
200 L A 1.4914
201 L A 0.6868
202 S A 0.0997
203 H A -0.2622
204 A A -0.4268
205 V A 0.0000
206 Y A -0.4114
207 E A -2.5008
208 D A -2.7847
209 I A 0.0000
210 S A -2.1115
211 H A -2.7569
212 V A 0.0000
213 Q A -2.7246
214 D A -2.7012
215 T A -1.3228
216 I A 0.0000
217 S A -1.5974
218 T A -0.7716
219 L A -0.8344
220 D A -1.8638
221 P A -1.4805
222 S A -1.1098
223 A A -1.1372
224 A A 0.0000
225 N A -1.9444
226 Q A -2.0715
227 V A -1.2775
228 V A 0.0000
229 D A -2.7933
230 Q A -2.7572
231 A A -2.2982
232 A A -2.1651
233 Q A -2.5528
234 Q A -2.7244
235 L A 0.0000
236 Q A -2.4398
237 D A -2.5270
238 A A -1.7791
239 L A 0.0000
240 K A -2.9440
241 Q A -2.5977
242 V A -1.5899
243 S A -2.0008
244 A A -2.0537
245 Q A -2.3314
246 N A -2.1870
247 K A -2.5212
248 P A -1.4145
249 A A -0.6903
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1997 3.0025 View CSV PDB
4.5 -1.2888 3.0114 View CSV PDB
5.0 -1.3876 3.0346 View CSV PDB
5.5 -1.4738 3.0805 View CSV PDB
6.0 -1.53 3.1411 View CSV PDB
6.5 -1.5539 3.1918 View CSV PDB
7.0 -1.554 3.2195 View CSV PDB
7.5 -1.5386 3.2307 View CSV PDB
8.0 -1.5115 3.2346 View CSV PDB
8.5 -1.4701 3.2358 View CSV PDB
9.0 -1.41 3.2363 View CSV PDB