Project name: 939bdd2012ac152

Status: done

Started: 2026-03-12 20:00:49
Chain sequence(s) A: MEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFNGGGGSFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:46)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/939bdd2012ac152/tmp/folded.pdb                (00:02:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:15)
Show buried residues

Minimal score value
-4.0253
Maximal score value
3.7636
Average score
-0.6801
Total score value
-159.1385

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.8502
2 E A 0.0000
3 P A 0.0000
4 R A -1.2756
5 I A -0.8275
6 Q A -1.5775
7 K A -2.1943
8 E A -2.0600
9 Y A -0.8581
10 Y A -0.1878
11 Y A -0.3983
12 N A -1.8727
13 L A -1.0960
14 H A -2.1370
15 E A -3.4047
16 N A -3.3970
17 N A -3.4332
18 S A -2.9489
19 Q A -3.1403
20 A A -2.4064
21 N A -2.8214
22 H A -2.6891
23 N A -2.7601
24 K A -2.3433
25 F A -0.3939
26 H A -1.4754
27 E A -2.1218
28 M A -0.8225
29 P A -1.3824
30 E A -2.1421
31 Y A -0.9441
32 D A -2.5824
33 D A -2.7317
34 Q A -2.0391
35 L A -0.1138
36 P A -0.4373
37 D A -0.9516
38 F A 0.5915
39 P A -0.9597
40 H A -1.8261
41 K A -2.3933
42 Q A -2.3048
43 L A -1.3024
44 E A -3.1537
45 E A -3.8347
46 E A -4.0253
47 Q A -3.2652
48 N A -2.4316
49 P A -0.9786
50 F A 0.7119
51 H A -0.9161
52 K A -1.1559
53 L A 0.8113
54 S A -0.1492
55 E A -0.9884
56 V A 1.2405
57 L A 1.2433
58 N A -0.7118
59 S A -0.3811
60 G A 0.1496
61 S A 0.6884
62 V A 2.5574
63 V A 3.0051
64 P A 2.5556
65 L A 3.5608
66 W A 3.1679
67 L A 3.0885
68 V A 2.7482
69 N A 0.8804
70 P A 1.5800
71 I A 3.3142
72 Y A 3.2018
73 Y A 3.4951
74 V A 3.7636
75 L A 3.0699
76 E A 1.1255
77 L A 2.2515
78 F A 1.7436
79 P A 0.2867
80 R A -0.5902
81 A A 0.4438
82 I A 2.2681
83 S A 1.7866
84 Y A 2.8751
85 Y A 2.6967
86 F A 2.3085
87 N A -0.2570
88 G A -0.7126
89 G A -1.0931
90 G A -1.3648
91 G A -1.3280
92 S A -1.1702
93 F A -1.1228
94 D A -2.2583
95 A A -1.9395
96 S A -2.1700
97 N A -2.4007
98 F A 0.0000
99 K A -2.2818
100 D A -1.3275
101 F A 0.0000
102 S A -0.8317
103 S A -1.1732
104 I A 0.0000
105 A A -0.5692
106 S A -0.7151
107 A A -0.7966
108 S A -0.7195
109 S A 0.0000
110 S A -0.1486
111 W A 0.0000
112 Q A -0.8204
113 N A 0.0000
114 Q A -1.6467
115 S A -1.1414
116 G A -1.0830
117 S A 0.0000
118 T A -0.6600
119 M A 0.0000
120 I A -0.1342
121 I A 0.0000
122 Q A -1.6168
123 V A 0.0000
124 D A -0.8991
125 S A 0.2416
126 F A 1.0579
127 G A -0.6494
128 N A -1.1946
129 V A 0.0000
130 S A -1.2314
131 G A -0.8089
132 Q A -0.8484
133 Y A 0.0000
134 V A 0.0000
135 N A 0.0000
136 R A -1.9899
137 A A 0.0000
138 Q A -1.7077
139 G A -1.1872
140 T A 0.0000
141 G A -1.3369
142 C A 0.0000
143 Q A -2.0127
144 N A -1.9285
145 S A 0.0000
146 P A -1.1149
147 Y A 0.0000
148 P A -0.8526
149 L A 0.0000
150 T A -0.9791
151 G A -1.1900
152 R A -1.9499
153 V A -0.9576
154 N A -1.1210
155 G A -0.9909
156 T A -0.0973
157 F A 0.9432
158 I A 0.0000
159 A A -0.3816
160 F A 0.0000
161 S A -0.6526
162 V A 0.0000
163 G A -1.1611
164 W A 0.0000
165 N A -2.6567
166 N A -1.7441
167 S A -1.1505
168 T A -1.4047
169 E A -2.2962
170 N A -2.7619
171 C A -1.9506
172 N A -2.3413
173 S A -1.3386
174 A A -0.4678
175 T A 0.0000
176 G A -0.6580
177 W A 0.0000
178 T A -0.0934
179 G A 0.0000
180 Y A 1.1778
181 A A 0.0000
182 Q A -0.4505
183 V A -1.2711
184 N A -1.7998
185 G A -1.6874
186 N A -2.2400
187 N A -1.7239
188 T A 0.0000
189 E A 0.0000
190 I A 0.0000
191 V A 0.2677
192 T A 0.0000
193 S A -0.9783
194 W A 0.0000
195 N A -1.0031
196 L A 0.0000
197 A A -0.1728
198 Y A 0.0000
199 E A -1.7811
200 G A -1.0824
201 G A -1.1046
202 S A -0.8176
203 G A -0.9706
204 P A -0.6554
205 A A 0.0625
206 I A 1.0601
207 E A -0.2492
208 Q A -1.4474
209 G A -1.5348
210 Q A -1.7015
211 D A 0.0000
212 T A -0.6543
213 F A 0.0000
214 Q A -0.8905
215 Y A 0.0000
216 V A 0.3251
217 P A -0.5070
218 T A -0.7499
219 T A -1.5831
220 E A -3.1385
221 N A -2.8510
222 K A -2.3745
223 S A -0.6147
224 L A 0.7819
225 L A 0.6799
226 K A -1.5593
227 D A -2.4629
228 T A -2.1670
229 H A -2.6758
230 H A -2.6549
231 H A -2.6758
232 H A -2.6736
233 H A -2.3806
234 H A -1.8870
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.237 6.0533 View CSV PDB
4.5 -0.3042 6.0533 View CSV PDB
5.0 -0.3846 6.0533 View CSV PDB
5.5 -0.4591 6.0533 View CSV PDB
6.0 -0.5087 6.0533 View CSV PDB
6.5 -0.5257 6.0533 View CSV PDB
7.0 -0.5194 6.0533 View CSV PDB
7.5 -0.5034 6.0533 View CSV PDB
8.0 -0.4833 6.0533 View CSV PDB
8.5 -0.4585 6.0533 View CSV PDB
9.0 -0.4278 6.0533 View CSV PDB