| Chain sequence(s) |
A: MASMTGGQQMGRGSEFELGTSRMHLDSVSSTGSTSNTDSSSKSAGSRTSGGSSTYGYSSSHRGGSVSSTGSSSNTDSSTKNAGSSTSGGSSTYGYSSSHRGGSVSSTGSSSNTDSSTKSAGSSTSGGSSTYGYSSRHRGGRVSSTGSSSTTDASSNSVGSSTSGGSSTYGYSSNSRDGSSIGSRARRLQRPACKLAAALEHHHHHH
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:03)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:03)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:03)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:03)
[INFO] FoldX: Starting FoldX energy minimization (00:00:03)
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimization (00:00:00)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:01:27)
[INFO] AutoMutEv:Residue number 1 from chain A and a score of 1.144 (methionine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 171 from chain A and a score of 0.999 (tyrosine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 195 from chain A and a score of 0.983 (leucine) selected for
automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 169 from chain A and a score of 0.976 (tyrosine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 181 from chain A and a score of 0.959 (isoleucine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 170 from chain A and a score of 0.867 (glycine) selected for
automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 4 from chain A and a score of 0.862 (methionine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 131 from chain A and a score of 0.859 (tyrosine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 150 from chain A and a score of 0.790 (threonine) selected
for automated mutation (00:01:28)
[INFO] AutoMutEv:Residue number 25 from chain A and a score of 0.743 (leucine) selected for
automated mutation (00:01:28)
[INFO] AutoMutEv:Mutating residue number 1 from chain A (methionine) into arginine (00:01:28)
[INFO] AutoMutEv:Mutating residue number 171 from chain A (tyrosine) into histidine (00:01:28)
[INFO] AutoMutEv:Mutating residue number 171 from chain A (tyrosine) into tryptophan (00:01:28)
[INFO] AutoMutEv:Mutating residue number 195 from chain A (leucine) into methionine (00:01:34)
[INFO] AutoMutEv:Mutating residue number 1 from chain A (methionine) into lysine (00:01:34)
[INFO] AutoMutEv:Mutating residue number 171 from chain A (tyrosine) into cysteine (00:01:36)
[INFO] AutoMutEv:Mutating residue number 169 from chain A (tyrosine) into histidine (00:01:39)
[INFO] AutoMutEv:Mutating residue number 169 from chain A (tyrosine) into tryptophan (00:01:41)
[INFO] AutoMutEv:Mutating residue number 181 from chain A (isoleucine) into methionine (00:01:41)
[INFO] AutoMutEv:Mutating residue number 181 from chain A (isoleucine) into threonine (00:01:48)
[INFO] AutoMutEv:Mutating residue number 181 from chain A (isoleucine) into leucine (00:01:48)
[INFO] AutoMutEv:Mutating residue number 169 from chain A (tyrosine) into cysteine (00:01:49)
[INFO] AutoMutEv:Mutating residue number 170 from chain A (glycine) into glutamic acid (00:01:56)
[INFO] AutoMutEv:Mutating residue number 170 from chain A (glycine) into asparagine (00:01:57)
[INFO] AutoMutEv:Mutating residue number 4 from chain A (methionine) into lysine (00:01:58)
[INFO] AutoMutEv:Mutating residue number 170 from chain A (glycine) into aspartic acid (00:02:02)
[INFO] AutoMutEv:Mutating residue number 4 from chain A (methionine) into arginine (00:02:03)
[INFO] AutoMutEv:Mutating residue number 131 from chain A (tyrosine) into histidine (00:02:05)
[INFO] AutoMutEv:Mutating residue number 131 from chain A (tyrosine) into cysteine (00:02:08)
[INFO] AutoMutEv:Mutating residue number 150 from chain A (threonine) into glutamic acid (00:02:10)
[INFO] AutoMutEv:Mutating residue number 131 from chain A (tyrosine) into tryptophan (00:02:16)
[INFO] AutoMutEv:Mutating residue number 150 from chain A (threonine) into aspartic acid (00:02:19)
[INFO] AutoMutEv:Mutating residue number 150 from chain A (threonine) into lysine (00:02:21)
[INFO] AutoMutEv:Mutating residue number 25 from chain A (leucine) into methionine (00:02:32)
[INFO] AutoMutEv:Effect of mutation residue number 1 from chain A (methionine) into
arginine: Energy difference: -0.1862 kcal/mol, Difference in average score
from the base case: -0.0259 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 1 from chain A (methionine) into lysine:
Energy difference: -0.2177 kcal/mol, Difference in average score from the
base case: -0.0246 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 171 from chain A (tyrosine) into
histidine: Energy difference: 0.3641 kcal/mol, Difference in average score
from the base case: -0.0343 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 171 from chain A (tyrosine) into
cysteine: Energy difference: 0.5015 kcal/mol, Difference in average score
from the base case: -0.0184 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 171 from chain A (tyrosine) into
tryptophan: Energy difference: 0.1396 kcal/mol, Difference in average score
from the base case: -0.0005 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 195 from chain A (leucine) into
methionine: Energy difference: 0.3458 kcal/mol, Difference in average score
from the base case: -0.0066 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 169 from chain A (tyrosine) into
histidine: Energy difference: 0.4166 kcal/mol, Difference in average score
from the base case: -0.0420 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 169 from chain A (tyrosine) into
cysteine: Energy difference: 0.3626 kcal/mol, Difference in average score
from the base case: -0.0097 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 169 from chain A (tyrosine) into
tryptophan: Energy difference: -0.2122 kcal/mol, Difference in average
score from the base case: -0.0030 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 181 from chain A (isoleucine) into
threonine: Energy difference: 0.4435 kcal/mol, Difference in average score
from the base case: -0.0351 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 181 from chain A (isoleucine) into
methionine: Energy difference: 0.1704 kcal/mol, Difference in average score
from the base case: -0.0157 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 181 from chain A (isoleucine) into
leucine: Energy difference: 0.0183 kcal/mol, Difference in average score
from the base case: -0.0066 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 170 from chain A (glycine) into glutamic
acid: Energy difference: 0.0769 kcal/mol, Difference in average score from
the base case: -0.0039 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 170 from chain A (glycine) into aspartic
acid: Energy difference: -0.0467 kcal/mol, Difference in average score from
the base case: -0.0035 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 170 from chain A (glycine) into
asparagine: Energy difference: -0.3934 kcal/mol, Difference in average
score from the base case: 0.0004 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 4 from chain A (methionine) into
arginine: Energy difference: -0.4266 kcal/mol, Difference in average score
from the base case: -0.0381 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 4 from chain A (methionine) into lysine:
Energy difference: -0.3083 kcal/mol, Difference in average score from the
base case: -0.0362 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 131 from chain A (tyrosine) into
histidine: Energy difference: 0.5323 kcal/mol, Difference in average score
from the base case: -0.0263 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 131 from chain A (tyrosine) into
cysteine: Energy difference: 0.8170 kcal/mol, Difference in average score
from the base case: -0.0128 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 131 from chain A (tyrosine) into
tryptophan: Energy difference: -0.3325 kcal/mol, Difference in average
score from the base case: -0.0041 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 150 from chain A (threonine) into
glutamic acid: Energy difference: 0.2945 kcal/mol, Difference in average
score from the base case: -0.0193 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 150 from chain A (threonine) into
aspartic acid: Energy difference: 1.0107 kcal/mol, Difference in average
score from the base case: -0.0148 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 150 from chain A (threonine) into lysine:
Energy difference: -0.3397 kcal/mol, Difference in average score from the
base case: -0.0354 (00:02:38)
[INFO] AutoMutEv:Effect of mutation residue number 25 from chain A (leucine) into
methionine: Energy difference: 0.0490 kcal/mol, Difference in average score
from the base case: -0.0088 (00:02:38)
[CRITICAL] Logger: IOError while writing to: finalRepair.out (00:03:03)
[INFO] Main: Simulation completed successfully. (00:02:44)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 1 | M | A | 1.1444 | |
| 2 | A | A | 0.7089 | |
| 3 | S | A | 0.5167 | |
| 4 | M | A | 0.8624 | |
| 5 | T | A | -0.1143 | |
| 6 | G | A | -0.9142 | |
| 7 | G | A | -1.3873 | |
| 8 | Q | A | -1.9162 | |
| 9 | Q | A | -1.7797 | |
| 10 | M | A | -0.6201 | |
| 11 | G | A | -1.5201 | |
| 12 | R | A | -2.4358 | |
| 13 | G | A | -1.7668 | |
| 14 | S | A | -1.8129 | |
| 15 | E | A | -2.3447 | |
| 16 | F | A | -1.0049 | |
| 17 | E | A | -2.1785 | |
| 18 | L | A | -1.0806 | |
| 19 | G | A | -1.3321 | |
| 20 | T | A | -1.1412 | |
| 21 | S | A | -1.3605 | |
| 22 | R | A | -1.8434 | |
| 23 | M | A | -0.4779 | |
| 24 | H | A | -0.6531 | |
| 25 | L | A | 0.7434 | |
| 26 | D | A | -0.2461 | |
| 27 | S | A | -0.1132 | |
| 28 | V | A | -0.0709 | |
| 29 | S | A | -0.2549 | |
| 30 | S | A | 0.0000 | |
| 31 | T | A | -0.3306 | |
| 32 | G | A | -0.8990 | |
| 33 | S | A | -0.8192 | |
| 34 | T | A | -0.7032 | |
| 35 | S | A | 0.0000 | |
| 36 | N | A | -1.1920 | |
| 37 | T | A | 0.0000 | |
| 38 | D | A | -1.9784 | |
| 39 | S | A | 0.0000 | |
| 40 | S | A | -1.4849 | |
| 41 | S | A | -1.7246 | |
| 42 | K | A | -2.9810 | |
| 43 | S | A | -1.7030 | |
| 44 | A | A | -1.1450 | |
| 45 | G | A | -0.5944 | |
| 46 | S | A | -0.1586 | |
| 47 | R | A | 0.0000 | |
| 48 | T | A | -0.2312 | |
| 49 | S | A | 0.0000 | |
| 50 | G | A | -0.4180 | |
| 51 | G | A | -0.5224 | |
| 52 | S | A | -0.6090 | |
| 53 | S | A | -0.3857 | |
| 54 | T | A | 0.0000 | |
| 55 | Y | A | 0.2995 | |
| 56 | G | A | 0.0000 | |
| 57 | Y | A | -0.2791 | |
| 58 | S | A | 0.0000 | |
| 59 | S | A | -1.4637 | |
| 60 | S | A | 0.0000 | |
| 61 | H | A | -3.3583 | |
| 62 | R | A | -3.6307 | |
| 63 | G | A | 0.0000 | |
| 64 | G | A | -1.2627 | |
| 65 | S | A | -0.3218 | |
| 66 | V | A | 0.0000 | |
| 67 | S | A | -0.2484 | |
| 68 | S | A | 0.0000 | |
| 69 | T | A | -0.2824 | |
| 70 | G | A | -0.4392 | |
| 71 | S | A | -0.5776 | |
| 72 | S | A | -0.2138 | |
| 73 | S | A | 0.0000 | |
| 74 | N | A | 0.0000 | |
| 75 | T | A | 0.0000 | |
| 76 | D | A | -0.3410 | |
| 77 | S | A | 0.0000 | |
| 78 | S | A | -0.8381 | |
| 79 | T | A | 0.0000 | |
| 80 | K | A | -3.8129 | |
| 81 | N | A | -3.1221 | |
| 82 | A | A | -1.7301 | |
| 83 | G | A | -1.2923 | |
| 84 | S | A | -0.2782 | |
| 85 | S | A | 0.0000 | |
| 86 | T | A | -0.2004 | |
| 87 | S | A | 0.0000 | |
| 88 | G | A | -0.2974 | |
| 89 | G | A | -0.4389 | |
| 90 | S | A | -0.5415 | |
| 91 | S | A | -0.3353 | |
| 92 | T | A | 0.0000 | |
| 93 | Y | A | 0.5662 | |
| 94 | G | A | 0.0000 | |
| 95 | Y | A | 0.2389 | |
| 96 | S | A | 0.0000 | |
| 97 | S | A | -1.1203 | |
| 98 | S | A | 0.0000 | |
| 99 | H | A | -3.2049 | |
| 100 | R | A | -3.6076 | |
| 101 | G | A | 0.0000 | |
| 102 | G | A | 0.0000 | |
| 103 | S | A | -0.3861 | |
| 104 | V | A | 0.0000 | |
| 105 | S | A | -0.2039 | |
| 106 | S | A | 0.0000 | |
| 107 | T | A | -0.3147 | |
| 108 | G | A | -0.4504 | |
| 109 | S | A | -0.5398 | |
| 110 | S | A | -0.2916 | |
| 111 | S | A | 0.0000 | |
| 112 | N | A | 0.3033 | |
| 113 | T | A | 0.0000 | |
| 114 | D | A | -0.0758 | |
| 115 | S | A | 0.0000 | |
| 116 | S | A | -0.6357 | |
| 117 | T | A | 0.0000 | |
| 118 | K | A | -3.4451 | |
| 119 | S | A | -2.8237 | |
| 120 | A | A | -1.6233 | |
| 121 | G | A | -1.3678 | |
| 122 | S | A | -0.6817 | |
| 123 | S | A | 0.0000 | |
| 124 | T | A | -0.3436 | |
| 125 | S | A | 0.0000 | |
| 126 | G | A | -0.3001 | |
| 127 | G | A | -0.4365 | |
| 128 | S | A | -0.5576 | |
| 129 | S | A | -0.3489 | |
| 130 | T | A | 0.0000 | |
| 131 | Y | A | 0.8585 | |
| 132 | G | A | 0.0000 | |
| 133 | Y | A | 0.5083 | |
| 134 | S | A | 0.0000 | |
| 135 | S | A | -1.0134 | |
| 136 | R | A | 0.0000 | |
| 137 | H | A | -3.1478 | |
| 138 | R | A | -3.3337 | |
| 139 | G | A | 0.0000 | |
| 140 | G | A | -1.3753 | |
| 141 | R | A | -1.2487 | |
| 142 | V | A | 0.0000 | |
| 143 | S | A | -0.3114 | |
| 144 | S | A | 0.0000 | |
| 145 | T | A | -0.2702 | |
| 146 | G | A | -0.4428 | |
| 147 | S | A | -0.5857 | |
| 148 | S | A | -0.1962 | |
| 149 | S | A | 0.0000 | |
| 150 | T | A | 0.7903 | |
| 151 | T | A | 0.0000 | |
| 152 | D | A | 0.4705 | |
| 153 | A | A | 0.0000 | |
| 154 | S | A | -0.5590 | |
| 155 | S | A | -2.0739 | |
| 156 | N | A | -2.8188 | |
| 157 | S | A | -2.2741 | |
| 158 | V | A | -1.3752 | |
| 159 | G | A | -1.4279 | |
| 160 | S | A | -0.6211 | |
| 161 | S | A | 0.0000 | |
| 162 | T | A | 0.1175 | |
| 163 | S | A | 0.0000 | |
| 164 | G | A | -0.4985 | |
| 165 | G | A | -0.8047 | |
| 166 | S | A | -1.1159 | |
| 167 | S | A | -0.5515 | |
| 168 | T | A | -0.2559 | |
| 169 | Y | A | 0.9763 | |
| 170 | G | A | 0.8673 | |
| 171 | Y | A | 0.9990 | |
| 172 | S | A | 0.1983 | |
| 173 | S | A | -0.8067 | |
| 174 | N | A | -2.1141 | |
| 175 | S | A | -2.3026 | |
| 176 | R | A | -3.1429 | |
| 177 | D | A | -2.7467 | |
| 178 | G | A | -2.0810 | |
| 179 | S | A | -0.7986 | |
| 180 | S | A | 0.2199 | |
| 181 | I | A | 0.9592 | |
| 182 | G | A | -0.1280 | |
| 183 | S | A | -1.1889 | |
| 184 | R | A | -2.6040 | |
| 185 | A | A | -2.2862 | |
| 186 | R | A | -3.0383 | |
| 187 | R | A | -2.8439 | |
| 188 | L | A | -1.0330 | |
| 189 | Q | A | -2.2261 | |
| 190 | R | A | -2.2356 | |
| 191 | P | A | -1.2653 | |
| 192 | A | A | -0.6311 | |
| 193 | C | A | 0.0663 | |
| 194 | K | A | -0.5847 | |
| 195 | L | A | 0.9829 | |
| 196 | A | A | 0.6430 | |
| 197 | A | A | 0.5139 | |
| 198 | A | A | 0.4351 | |
| 199 | L | A | 0.3630 | |
| 200 | E | A | -1.8795 | |
| 201 | H | A | -2.3496 | |
| 202 | H | A | -2.4769 | |
| 203 | H | A | -2.6478 | |
| 204 | H | A | -2.5338 | |
| 205 | H | A | -2.2075 | |
| 206 | H | A | -1.7228 |
Automated mutations analysis - evolutionary conserved mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated based off an evolutionary approach.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| MR4A | -0.4266 | -0.0381 | View | CSV | PDB |
| TK150A | -0.3397 | -0.0354 | View | CSV | PDB |
| MK4A | -0.3083 | -0.0362 | View | CSV | PDB |
| MR1A | -0.1862 | -0.0259 | View | CSV | PDB |
| MK1A | -0.2177 | -0.0246 | View | CSV | PDB |
| YW131A | -0.3325 | -0.0041 | View | CSV | PDB |
| YW169A | -0.2122 | -0.003 | View | CSV | PDB |
| GD170A | -0.0467 | -0.0035 | View | CSV | PDB |
| IL181A | 0.0183 | -0.0066 | View | CSV | PDB |
| LM25A | 0.049 | -0.0088 | View | CSV | PDB |
| YH169A | 0.4166 | -0.042 | View | CSV | PDB |
| YH171A | 0.3641 | -0.0343 | View | CSV | PDB |
| IM181A | 0.1704 | -0.0157 | View | CSV | PDB |
| TE150A | 0.2945 | -0.0193 | View | CSV | PDB |
| GE170A | 0.0769 | -0.0039 | View | CSV | PDB |
| YH131A | 0.5323 | -0.0263 | View | CSV | PDB |
| YC171A | 0.5015 | -0.0184 | View | CSV | PDB |
| LM195A | 0.3458 | -0.0066 | View | CSV | PDB |