Project name: 960f00521c316ff

Status: done

Started: 2026-02-24 06:44:23
Chain sequence(s) A: QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYTIHWVRQATGQGLEWMGWIYPLRGSINYAQKFQGRVTMTADKSISTVYMELSSLRSEDTAVYFCARHGAYYSNAFDYWGQGTLVTVSS
B: EIVMTQSPATLSVSPGERATLSCRASESVDNDGIRFLHWYQQKPGQAPRLLIYRASTRATGIPARFSGSGSRTEFTLTISSLQSEDFAVYYCQQSNKDPYTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/960f00521c316ff/tmp/folded.pdb                (00:03:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:19)
Show buried residues

Minimal score value
-3.3019
Maximal score value
1.8134
Average score
-0.6375
Total score value
-147.2706

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4698
2 V A -0.8691
3 Q A -0.9360
4 L A 0.0000
5 V A 0.6458
6 Q A 0.0000
7 S A -0.4226
8 G A -0.3997
9 A A 0.2713
10 E A 0.0508
11 V A 0.9691
12 K A -1.0280
13 K A -2.1810
14 P A -2.1727
15 G A -1.5203
16 A A -1.2080
17 S A -1.2870
18 V A 0.0000
19 K A -1.9378
20 V A 0.0000
21 S A -0.4788
22 C A 0.0000
23 K A -0.6904
24 A A 0.0000
25 S A -0.6705
26 G A -1.0291
27 Y A -0.5778
28 T A -0.4615
29 F A 0.0000
30 T A -0.8514
31 D A -0.9223
32 Y A -0.1299
33 T A 0.1888
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.3592
39 Q A -0.6004
40 A A -0.8754
41 T A -0.5994
42 G A -1.1771
43 Q A -1.7259
44 G A -1.1441
45 L A 0.0000
46 E A -0.6740
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 W A 0.4937
51 I A 0.0000
52 Y A 0.1006
53 P A 0.0000
54 L A -0.7356
55 R A -1.5812
56 G A -0.8846
57 S A -0.0902
58 I A 0.7700
59 N A -0.0457
60 Y A -0.7141
61 A A 0.0000
62 Q A -2.5844
63 K A -2.6928
64 F A 0.0000
65 Q A -2.4062
66 G A -1.5606
67 R A -1.1605
68 V A 0.0000
69 T A -0.5083
70 M A 0.0000
71 T A -0.2016
72 A A -0.9363
73 D A -1.4274
74 K A -1.9234
75 S A -0.7128
76 I A 0.0738
77 S A -0.7686
78 T A 0.0000
79 V A 0.0000
80 Y A -0.5168
81 M A 0.0000
82 E A -1.2066
83 L A 0.0000
84 S A -0.9662
85 S A -1.0905
86 L A 0.0000
87 R A -2.7379
88 S A -2.2881
89 E A -2.4331
90 D A 0.0000
91 T A -0.6957
92 A A 0.0000
93 V A 0.3884
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 H A 0.0000
100 G A 0.0000
101 A A 0.8366
102 Y A 1.8134
103 Y A 1.8094
104 S A 0.6936
105 N A 0.3843
106 A A 0.0000
107 F A 0.0000
108 D A -0.1753
109 Y A -0.0037
110 W A -0.2598
111 G A 0.0000
112 Q A -1.0654
113 G A -0.4318
114 T A 0.0000
115 L A 0.8646
116 V A 0.0000
117 T A -0.1319
118 V A 0.0000
119 S A -1.0897
120 S A -1.1456
1 E B -2.0561
2 I B 0.0000
3 V B 0.6311
4 M B 0.0000
5 T B -0.6062
6 Q B -0.6012
7 S B -0.6848
8 P B -0.3941
9 A B -0.3933
10 T B -0.5929
11 L B -0.3275
12 S B -0.5787
13 V B 0.0000
14 S B -1.1361
15 P B -1.5457
16 G B -1.7756
17 E B -2.4155
18 R B -2.6841
19 A B 0.0000
20 T B -0.5369
21 L B 0.0000
22 S B -0.9673
23 C B 0.0000
24 R B -2.6939
25 A B 0.0000
26 S B -1.5595
27 E B -2.6616
28 S B -2.6745
29 V B 0.0000
30 D B 0.0000
31 N B -2.4265
32 D B -2.4198
33 G B -1.5105
34 I B -1.2582
35 R B -1.6394
36 F B -1.0155
37 L B 0.0000
38 H B 0.0000
39 W B 0.0000
40 Y B 0.0000
41 Q B 0.0000
42 Q B 0.0000
43 K B -1.5571
44 P B -1.1604
45 G B -1.4419
46 Q B -2.1996
47 A B -1.5034
48 P B 0.0000
49 R B -2.0130
50 L B 0.0000
51 L B 0.0000
52 I B 0.0000
53 Y B -0.4823
54 R B -0.8624
55 A B 0.0000
56 S B -0.8001
57 T B -0.8278
58 R B -1.3107
59 A B -0.8998
60 T B -0.5673
61 G B -0.5979
62 I B -0.4403
63 P B -0.3947
64 A B -0.3738
65 R B -0.6349
66 F B 0.0000
67 S B -0.5176
68 G B 0.0000
69 S B -0.7235
70 G B -1.5006
71 S B -1.9799
72 R B -3.1943
73 T B -3.0173
74 E B -3.3019
75 F B 0.0000
76 T B -0.8482
77 L B 0.0000
78 T B -0.5733
79 I B 0.0000
80 S B -1.3061
81 S B -1.6240
82 L B 0.0000
83 Q B -1.8650
84 S B -1.2940
85 E B -2.1423
86 D B 0.0000
87 F B -0.6489
88 A B 0.0000
89 V B -0.5387
90 Y B 0.0000
91 Y B 0.0000
92 C B 0.0000
93 Q B 0.0000
94 Q B 0.0000
95 S B 0.0000
96 N B -1.4230
97 K B -2.5699
98 D B -2.1191
99 P B -1.7996
100 Y B -0.7490
101 T B -0.3159
102 F B 0.2532
103 G B 0.0000
104 G B -0.6900
105 G B -0.7150
106 T B 0.0000
107 K B -1.0260
108 V B 0.0000
109 E B -0.7045
110 I B 0.5173
111 K B -1.0444
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7397 2.4137 View CSV PDB
4.5 -0.7735 2.4122 View CSV PDB
5.0 -0.8157 2.4078 View CSV PDB
5.5 -0.8571 2.397 View CSV PDB
6.0 -0.8874 2.3767 View CSV PDB
6.5 -0.897 2.3484 View CSV PDB
7.0 -0.8839 2.3157 View CSV PDB
7.5 -0.8555 2.2812 View CSV PDB
8.0 -0.8196 2.2457 View CSV PDB
8.5 -0.7799 2.2084 View CSV PDB
9.0 -0.7377 2.1659 View CSV PDB