Project name: GFP

Status: done

Started: 2026-05-12 12:35:34
Chain sequence(s) A: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:13)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:13)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:13)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:13)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:14)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:14)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:51)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9626337a55a4907/tmp/folded.pdb                (00:06:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:06)
Show buried residues

Minimal score value
-3.9273
Maximal score value
1.1865
Average score
-0.8188
Total score value
-195.6921

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.3059
2 S A -0.8629
3 K A -1.8985
4 G A 0.0000
5 E A 0.0000
6 E A -1.8999
7 L A -0.6740
8 F A 0.0000
9 T A -0.2851
10 G A 0.4693
11 V A 1.1865
12 V A 0.0000
13 P A -0.9477
14 I A 0.0000
15 L A -1.1816
16 V A 0.0000
17 E A -2.1116
18 L A 0.0000
19 D A -3.2608
20 G A 0.0000
21 D A -2.4017
22 V A 0.0000
23 N A -2.0032
24 G A -1.6970
25 H A -2.3553
26 K A -2.9515
27 F A 0.0000
28 S A -1.7739
29 V A 0.0000
30 S A -1.2369
31 G A 0.0000
32 E A -2.3931
33 G A -1.7734
34 E A -1.5075
35 G A 0.0000
36 D A 0.1011
37 A A 0.0000
38 T A 0.2811
39 Y A 0.8220
40 G A 0.0000
41 K A -0.1706
42 L A 0.0000
43 T A -0.6521
44 L A 0.0000
45 K A -1.4337
46 F A 0.0000
47 I A 0.0000
48 C A 0.0000
49 T A -0.7742
50 T A -1.3411
51 G A -1.6324
52 K A -2.2285
53 L A 0.0000
54 P A -1.2299
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A 0.0000
63 T A 0.0000
64 L A 0.0000
65 S A 0.0000
66 Y A 0.0000
67 G A 0.0000
68 V A 0.0000
69 Q A 0.0000
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.0033
74 Y A 0.0000
75 P A -1.4928
76 D A -2.2890
77 H A -1.6917
78 M A 0.0000
79 K A -1.7011
80 Q A -1.6716
81 H A -1.1285
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A 0.0000
87 A A 0.0000
88 M A 0.0000
89 P A -1.4269
90 E A -2.2244
91 G A 0.0000
92 Y A 0.0000
93 V A -0.5516
94 Q A 0.0000
95 E A -1.9737
96 R A 0.0000
97 T A -0.3584
98 I A 0.0000
99 F A 0.4415
100 F A 0.0000
101 K A -2.1695
102 D A -2.7686
103 D A -2.3833
104 G A 0.0000
105 N A -0.6199
106 Y A 0.0000
107 K A -1.7022
108 T A 0.0000
109 R A -2.9414
110 A A 0.0000
111 E A -1.9908
112 V A 0.0000
113 K A -1.4680
114 F A -1.4859
115 E A -1.7230
116 G A -1.7196
117 D A -2.1198
118 T A -1.4141
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.4932
123 I A 0.0000
124 E A -3.7348
125 L A 0.0000
126 K A -2.5098
127 G A 0.0000
128 I A -0.8239
129 D A -2.1311
130 F A 0.0000
131 K A -3.8718
132 E A -3.9273
133 D A -3.4981
134 G A -2.7842
135 N A -1.7032
136 I A 0.0000
137 L A -1.9958
138 G A -2.1862
139 H A -1.4693
140 K A -1.2109
141 L A 0.0000
142 E A -0.5965
143 Y A -0.1184
144 N A -0.6213
145 Y A -0.8664
146 N A -1.2285
147 S A -1.2374
148 H A 0.0000
149 N A -1.3864
150 V A 0.0000
151 Y A 0.1071
152 I A 0.0000
153 M A -0.8650
154 A A -1.5868
155 D A 0.0000
156 K A -3.0460
157 Q A -2.9608
158 K A -3.0664
159 N A -2.7439
160 G A 0.0000
161 I A 0.0000
162 K A -1.0032
163 A A 0.0000
164 N A -0.3657
165 F A 0.0000
166 K A -1.5065
167 I A 0.0000
168 R A -1.8985
169 H A 0.0000
170 N A -0.9730
171 I A -0.8098
172 V A -0.3376
173 E A -2.2582
174 D A -2.4588
175 G A -1.4317
176 S A -0.8982
177 V A -0.3471
178 Q A 0.0000
179 L A -1.0872
180 A A 0.0000
181 D A -0.5105
182 H A 0.0000
183 Y A 0.4278
184 Q A 0.0000
185 Q A -1.0595
186 N A 0.0000
187 T A -0.6600
188 P A -0.7638
189 I A -0.1145
190 G A -1.1993
191 D A -2.1680
192 G A -1.4151
193 P A -0.9213
194 V A -0.4830
195 L A -0.0217
196 L A -0.6167
197 P A 0.0000
198 D A -2.2805
199 N A -1.6541
200 H A 0.0000
201 Y A -0.0795
202 L A 0.0000
203 S A -0.6986
204 T A 0.0000
205 Q A -1.2118
206 S A 0.0000
207 A A 0.1063
208 L A 0.0134
209 S A -0.6579
210 K A -1.7016
211 D A -1.9961
212 P A -1.7599
213 N A -2.3925
214 E A -2.5634
215 K A -2.9509
216 R A -2.9438
217 D A -2.0707
218 H A 0.0000
219 M A 0.0000
220 V A -0.4214
221 L A 0.0000
222 L A 0.5913
223 E A 0.0000
224 F A 0.2612
225 V A 0.0000
226 T A -0.3778
227 A A 0.0000
228 A A -0.3224
229 G A -0.6124
230 I A -0.7192
231 T A -0.5345
232 H A -1.4527
233 G A -1.2305
234 M A -0.3026
235 D A -1.9540
236 E A -1.9996
237 L A 0.4179
238 Y A 0.3564
239 K A -1.4112
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6886 1.6884 View CSV PDB
4.5 -0.7618 1.6118 View CSV PDB
5.0 -0.8511 1.5374 View CSV PDB
5.5 -0.9406 1.4861 View CSV PDB
6.0 -1.0121 1.481 View CSV PDB
6.5 -1.0512 1.5306 View CSV PDB
7.0 -1.0566 1.6215 View CSV PDB
7.5 -1.0388 1.7353 View CSV PDB
8.0 -1.0082 1.8627 View CSV PDB
8.5 -0.9678 2.0057 View CSV PDB
9.0 -0.9164 2.1701 View CSV PDB