Project name: 962f695113d70d9

Status: done

Started: 2026-07-13 02:20:05
Chain sequence(s) A: EVKLVESGGDLVKPGGSLKLSCAASGFTFTTYAMSWVRQTQDKRLEWVATISKGGTYTFYPDSVKGRFTISRDNAKDTLYLQMSSLRSEDTAMYYCARHQTGTRYFDVWGVGTTVTVSSGGGGSGGGGSGGGGSDIVMTQSPSSMYASLGERITITCKASHDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISGLEYDDLGIYYCLQYGEFPPYKFGSGTKLELK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/962f695113d70d9/tmp/folded.pdb                (00:02:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:45)
Show buried residues

Minimal score value
-3.3288
Maximal score value
1.2862
Average score
-0.7622
Total score value
-184.4476

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0556
2 V A -1.1525
3 K A -1.4542
4 L A 0.0000
5 V A 0.8311
6 E A 0.0000
7 S A -0.3782
8 G A -1.2002
9 G A -1.1766
10 D A -1.5156
11 L A -0.1820
12 V A 0.0000
13 K A -2.0860
14 P A 0.0000
15 G A -1.3776
16 G A -1.0080
17 S A -1.1378
18 L A -1.1392
19 K A -1.8198
20 L A 0.0000
21 S A -0.4319
22 C A 0.0000
23 A A -0.4632
24 A A 0.0000
25 S A -1.0707
26 G A -1.0389
27 F A -0.4164
28 T A -0.1228
29 F A 0.0000
30 T A -1.2062
31 T A -0.6726
32 Y A -0.5957
33 A A -0.6498
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -1.5333
40 T A -2.2981
41 Q A -2.8020
42 D A -3.3288
43 K A -3.1911
44 R A -2.7395
45 L A 0.0000
46 E A -1.2889
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 I A 0.0000
52 S A -0.5027
53 K A -1.8543
54 G A -1.3025
55 G A -0.7394
56 T A 0.0460
57 Y A 1.1010
58 T A 1.0567
59 F A 0.8625
60 Y A -0.5093
61 P A -1.6266
62 D A -2.8721
63 S A -2.1130
64 V A 0.0000
65 K A -2.5412
66 G A -1.7467
67 R A -1.5279
68 F A 0.0000
69 T A -0.7876
70 I A 0.0000
71 S A -0.2832
72 R A -1.1751
73 D A -1.4618
74 N A -1.8560
75 A A -1.3740
76 K A -2.3552
77 D A -1.9102
78 T A -1.0916
79 L A 0.0000
80 Y A -0.4629
81 L A 0.0000
82 Q A -1.4260
83 M A 0.0000
84 S A -0.9930
85 S A -0.9512
86 L A 0.0000
87 R A -1.9184
88 S A -1.5637
89 E A -1.6892
90 D A 0.0000
91 T A -0.8231
92 A A 0.0000
93 M A 0.0088
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 H A 0.0000
100 Q A -0.6629
101 T A -0.6337
102 G A -0.7775
103 T A -0.7338
104 R A -0.9986
105 Y A 0.0000
106 F A 0.0000
107 D A -0.5919
108 V A -0.1223
109 W A 0.0000
110 G A 0.0000
111 V A 1.2862
112 G A 0.5655
113 T A 0.0078
114 T A -0.4021
115 V A 0.0000
116 T A -0.7093
117 V A 0.0000
118 S A -1.2182
119 S A -1.1397
120 G A -1.0912
121 G A -1.0564
122 G A -1.4070
123 G A -1.6116
124 S A -1.5570
125 G A -1.1319
126 G A -1.2054
127 G A -1.4691
128 G A -1.3171
129 S A -1.2476
130 G A -1.4137
131 G A -1.7973
132 G A -1.5662
133 G A -1.4419
134 S A -0.8674
135 D A -0.9946
136 I A -0.1092
137 V A 1.0126
138 M A 0.0000
139 T A -0.2802
140 Q A 0.0000
141 S A -0.5518
142 P A -0.4578
143 S A -0.5942
144 S A -0.4327
145 M A 0.1847
146 Y A 0.6181
147 A A -0.5688
148 S A -0.8175
149 L A -0.2131
150 G A -1.2755
151 E A -2.5870
152 R A -2.8486
153 I A 0.0000
154 T A -0.5444
155 I A 0.0000
156 T A -0.7783
157 C A 0.0000
158 K A -1.9062
159 A A 0.0000
160 S A -0.9782
161 H A -2.0465
162 D A -2.5794
163 I A 0.0000
164 N A -1.9770
165 S A -1.2203
166 Y A -0.9377
167 L A 0.0000
168 S A 0.0000
169 W A 0.0000
170 F A 0.0000
171 Q A 0.0000
172 Q A 0.0000
173 K A -1.4718
174 P A -1.1213
175 G A -1.2603
176 K A -1.9102
177 S A -0.8811
178 P A 0.0000
179 K A -1.6785
180 T A 0.0000
181 L A 0.0000
182 I A 0.0000
183 Y A -0.9751
184 R A -1.5150
185 A A 0.0000
186 N A -2.3332
187 R A -2.5144
188 L A -1.1548
189 V A -1.2160
190 D A -1.9452
191 G A -1.1588
192 V A -0.7235
193 P A -0.5382
194 S A -0.4276
195 R A -1.0020
196 F A 0.0000
197 S A -0.9266
198 G A -1.2065
199 S A -1.4970
200 G A -1.5173
201 S A -1.6423
202 G A -1.9979
203 Q A -2.5777
204 D A -2.8260
205 Y A 0.0000
206 S A -0.9603
207 L A 0.0000
208 T A -0.6452
209 I A 0.0000
210 S A -1.7965
211 G A -1.8016
212 L A 0.0000
213 E A -1.3747
214 Y A -0.1041
215 D A -1.3933
216 D A 0.0000
217 L A -0.3779
218 G A 0.0000
219 I A -0.4845
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 L A 0.0000
224 Q A 0.0000
225 Y A 0.0000
226 G A -1.1872
227 E A -1.8779
228 F A -1.0318
229 P A -0.7542
230 P A -0.9815
231 Y A 0.0000
232 K A -0.5580
233 F A 0.0000
234 G A 0.0000
235 S A -0.9855
236 G A -0.8320
237 T A 0.0000
238 K A -0.9140
239 L A 0.0000
240 E A -0.4980
241 L A -0.5877
242 K A -1.0035
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7082 2.5329 View CSV PDB
4.5 -0.7529 2.4932 View CSV PDB
5.0 -0.8063 2.4513 View CSV PDB
5.5 -0.8575 2.413 View CSV PDB
6.0 -0.8944 2.3859 View CSV PDB
6.5 -0.9088 2.3777 View CSV PDB
7.0 -0.9019 2.3876 View CSV PDB
7.5 -0.8818 2.4086 View CSV PDB
8.0 -0.8545 2.4364 View CSV PDB
8.5 -0.821 2.4721 View CSV PDB
9.0 -0.7795 2.5191 View CSV PDB