Project name: HSA6F10_prot3D_74_015M

Status: done

Started: 2026-02-25 09:14:54
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQTYDHLLQSWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/96884fd513c06fe/tmp/folded.pdb                (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:27)
Show buried residues

Minimal score value
-2.8978
Maximal score value
1.5145
Average score
-0.5584
Total score value
-128.4407

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.5368
2 S A 0.6731
3 V A 1.4573
4 L A 0.0000
5 T A 0.0979
6 Q A 0.0000
7 P A -0.4389
8 P A -0.6733
9 S A -0.5933
11 V A -0.1394
12 S A -0.3074
13 G A 0.0000
14 A A -0.2511
15 P A -0.9608
16 G A -1.8179
17 Q A -2.5427
18 R A -2.6800
19 V A 0.0000
20 T A -0.5159
21 I A 0.0000
22 S A -0.2681
23 C A 0.0000
24 T A -0.1389
25 G A 0.0000
26 S A -0.0893
27 S A -0.5855
28 S A 0.0027
29 N A 0.0000
30 I A 0.0000
31 G A -0.8966
35 A A -0.5540
36 G A -0.6772
37 Y A -0.2700
38 D A -0.8359
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.4608
44 Q A 0.0000
45 L A -0.2893
46 P A -0.5027
47 G A -0.3927
48 T A -0.3819
49 A A -0.4777
50 P A 0.0000
51 K A -1.0677
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.1915
56 G A -1.2537
57 N A -1.0547
65 S A -1.2709
66 N A -1.9169
67 R A -2.0841
68 P A -1.3077
69 S A -0.8039
70 G A -0.8075
71 V A -0.8395
72 P A -1.2993
74 D A -2.1569
75 R A -1.5275
76 F A 0.0000
77 S A -0.9659
78 G A -0.7805
79 S A -0.6625
80 K A -1.0482
83 S A -0.8282
84 G A -0.9445
85 T A -0.7523
86 S A -0.6579
87 A A 0.0000
88 S A -0.4257
89 L A 0.0000
90 A A -0.5715
91 I A 0.0000
92 T A -1.8996
93 G A -1.8514
94 L A 0.0000
95 Q A -1.6288
96 A A -1.3580
97 E A -2.3209
98 D A 0.0000
99 E A -1.9751
100 A A 0.0000
101 D A -0.9473
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 T A 0.0000
107 Y A 0.4152
108 D A 0.0000
109 H A 0.0330
110 L A 1.2943
113 L A 0.5791
114 Q A -0.4103
115 S A 0.0000
116 W A 0.2368
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4587
121 G A 0.0000
122 T A 0.0000
123 K A -1.1601
124 V A 0.0000
125 T A -0.5078
126 V A 0.0679
127 L A 1.3715
1 Q B -0.7804
2 V B 0.4117
3 Q B -0.1930
4 L B 0.0000
5 V B 0.6714
6 Q B -0.0008
7 S B -0.6906
8 G B -0.9001
9 G B -0.5747
11 G B 0.4253
12 V B 1.5145
13 V B 0.1344
14 Q B -1.5767
15 P B -2.3356
16 G B -2.2422
17 R B -2.8542
18 S B -1.9991
19 L B -1.2572
20 R B -2.0832
21 L B 0.0000
22 S B -0.5339
23 C B 0.0000
24 A B -0.1980
25 A B -0.1543
26 S B -0.2439
27 G B -0.2422
28 F B 0.0483
29 T B -0.4784
30 F B -0.4011
35 S B 0.0576
36 S B 0.4639
37 Y B 0.7602
38 G B 0.4112
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7363
45 A B -1.0617
46 P B -0.9634
47 G B -1.4732
48 K B -2.2102
49 G B -1.4203
50 L B 0.0000
51 E B -0.5842
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.1785
58 Y B 0.4778
59 D B -1.5594
62 G B -0.9166
63 S B -0.8523
64 N B -0.6580
65 K B -0.7661
66 Y B -0.2168
67 Y B -0.6574
68 A B 0.0000
69 D B -2.5545
70 S B -1.9681
71 V B 0.0000
72 K B -2.5119
74 G B -1.7319
75 R B -1.6922
76 F B 0.0000
77 T B -0.7703
78 I B 0.0000
79 S B -0.7533
80 R B -1.2623
81 D B -1.6775
82 N B -1.7871
83 S B -1.5938
84 K B -2.2773
85 N B -1.5628
86 T B -0.9809
87 L B 0.0000
88 Y B -0.5165
89 L B 0.0000
90 Q B -1.2045
91 M B 0.0000
92 N B -2.2699
93 S B -2.0758
94 L B 0.0000
95 R B -2.8978
96 A B -1.7943
97 E B -2.1207
98 D B 0.0000
99 T B -0.4422
100 A B 0.0000
101 V B 0.2377
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4551
107 D B 0.0000
108 G B -0.7584
109 S B -0.8074
110 P B -1.2729
112 R B -2.0479
113 G B -1.4509
114 G B 0.0000
115 M B 0.0000
116 D B -1.1259
117 V B -0.4402
118 W B 0.0000
119 G B 0.0000
120 Q B -1.0024
121 G B -0.4807
122 T B 0.0000
123 T B 0.0736
124 V B 0.0000
125 T B 0.2803
126 V B -0.7495
127 S B -0.4661
128 S B -0.4823
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5253 2.2603 View CSV PDB
4.5 -0.5567 2.235 View CSV PDB
5.0 -0.5915 2.2014 View CSV PDB
5.5 -0.6242 2.1652 View CSV PDB
6.0 -0.6494 2.132 View CSV PDB
6.5 -0.6636 2.1073 View CSV PDB
7.0 -0.6678 2.0937 View CSV PDB
7.5 -0.6659 2.088 View CSV PDB
8.0 -0.6601 2.086 View CSV PDB
8.5 -0.6502 2.0853 View CSV PDB
9.0 -0.6349 2.0851 View CSV PDB