Project name: 96b492b44a0142e

Status: done

Started: 2026-07-09 01:43:27
Chain sequence(s) A: QVQLVESGGGVVQPGGSLRLSCAASGFTFTNYVMHWVRQAPGKGLEWVAVISHDGNNKYYVDVSVKGRFTISRDSKNTLYLQMNSLRAEDTAVYYCAREGIDFWSGLNWFDPWGQGTLVTVSS
B: EIVLTQSPGTLSLSPGERATLSCRASQSITGSYLAWYQQKPGQAPRLLICGASSWATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSSSPITFGQGTRLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:46)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/96b492b44a0142e/tmp/folded.pdb                (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:51)
Show buried residues

Minimal score value
-3.4218
Maximal score value
2.5381
Average score
-0.5624
Total score value
-129.9193

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.0876
2 V A -0.2861
3 Q A -0.5992
4 L A 0.0000
5 V A 0.4859
6 E A 0.0000
7 S A -0.3874
8 G A -0.8198
9 G A 0.0177
10 G A 0.8209
11 V A 1.5027
12 V A 0.0000
13 Q A -1.2976
14 P A -1.5126
15 G A -1.4469
16 G A -1.0370
17 S A -1.5380
18 L A -1.0997
19 R A -2.3207
20 L A 0.0000
21 S A -0.5128
22 C A 0.0000
23 A A -0.0709
24 A A 0.0000
25 S A -0.5623
26 G A -0.6445
27 F A -0.3107
28 T A -0.5568
29 F A 0.0000
30 T A -1.6041
31 N A -1.3979
32 Y A -0.4878
33 V A -0.1776
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.4588
39 Q A -0.7757
40 A A -1.1394
41 P A -0.8978
42 G A -1.5001
43 K A -2.3415
44 G A -1.4967
45 L A 0.0000
46 E A -0.9818
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 V A 0.2700
51 I A 0.0000
52 S A -1.6722
53 H A -2.1486
54 D A -2.9932
55 G A -2.3840
56 N A -2.8111
57 N A -2.3467
58 K A -1.1008
59 Y A 0.3664
60 Y A 0.0999
61 V A -0.3978
62 D A -1.0690
63 V A 0.1292
64 S A -0.6021
65 V A 0.0000
66 K A -1.6523
67 G A -1.4919
68 R A -1.4968
69 F A 0.0000
70 T A -1.1023
71 I A 0.0000
72 S A -0.7020
73 R A -1.2280
74 D A -1.3774
75 S A -1.6613
76 K A -2.1088
77 N A -1.3705
78 T A -0.6887
79 L A 0.0000
80 Y A -0.5785
81 L A 0.0000
82 Q A -1.7168
83 M A 0.0000
84 N A -2.1525
85 S A -1.4740
86 L A 0.0000
87 R A -2.1016
88 A A -1.6059
89 E A -2.1295
90 D A 0.0000
91 T A -0.3889
92 A A 0.0000
93 V A 0.4991
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.1626
99 E A 0.0000
100 G A 0.0000
101 I A 2.2186
102 D A 1.6135
103 F A 2.5381
104 W A 2.2213
105 S A 1.2774
106 G A 1.0780
107 L A 1.4083
108 N A 0.0000
109 W A 0.3370
110 F A 0.0000
111 D A -0.9732
112 P A -1.1047
113 W A 0.0000
114 G A 0.0000
115 Q A -1.3540
116 G A 0.0000
117 T A 0.3172
118 L A 1.3128
119 V A 0.0000
120 T A 0.3512
121 V A 0.0000
122 S A -0.7198
123 S A -0.6501
1 E B -1.4340
2 I B -0.1794
3 V B 0.8227
4 L B 0.0000
5 T B -0.6561
6 Q B 0.0000
7 S B -0.8364
8 P B -0.4700
9 G B -0.6512
10 T B -0.7747
11 L B -0.4893
12 S B -0.7874
13 L B -0.7909
14 S B -1.1723
15 P B -1.7509
16 G B -2.0493
17 E B -2.5192
18 R B -3.0800
19 A B 0.0000
20 T B -0.5485
21 L B 0.0000
22 S B -0.9794
23 C B 0.0000
24 R B -2.3470
25 A B 0.0000
26 S B -0.9638
27 Q B -1.6547
28 S B -1.3767
29 I B 0.0000
30 T B -0.5518
31 G B -0.5512
32 S B -0.5672
33 Y B 0.1196
34 L B 0.0000
35 A B 0.0000
36 W B 0.0000
37 Y B 0.0000
38 Q B 0.0000
39 Q B 0.0000
40 K B -1.3436
41 P B -0.9829
42 G B -1.4203
43 Q B -2.1420
44 A B -1.6029
45 P B 0.0000
46 R B -2.2062
47 L B 0.0000
48 L B 0.0000
49 I B 0.0000
50 C B 0.0000
51 G B -0.1430
52 A B 0.0000
53 S B -0.1650
54 S B 0.2518
55 W B 0.7385
56 A B 0.1164
57 T B -0.0297
58 G B -0.4326
59 I B -0.4205
60 P B -0.9009
61 D B -2.0432
62 R B -2.0856
63 F B 0.0000
64 S B -0.4216
65 G B 0.0000
66 S B -0.6877
67 G B -1.1156
68 S B -1.1000
69 G B -1.2443
70 T B -1.7377
71 D B -2.1892
72 F B 0.0000
73 T B -0.8038
74 L B 0.0000
75 T B -0.7901
76 I B 0.0000
77 S B -2.3948
78 R B -3.4218
79 L B 0.0000
80 E B -2.5353
81 P B -1.5445
82 E B -2.3208
83 D B 0.0000
84 F B -0.8575
85 A B 0.0000
86 V B -0.4092
87 Y B 0.0000
88 Y B 0.0000
89 C B 0.0000
90 Q B 0.0000
91 Q B 0.0000
92 Y B 0.0000
93 S B 0.0906
94 S B -0.3257
95 S B -0.2990
96 P B -0.5282
97 I B 0.0735
98 T B 0.0648
99 F B 0.2057
100 G B 0.0000
101 Q B -1.0485
102 G B 0.0000
103 T B 0.0000
104 R B -1.3060
105 L B 0.0000
106 E B -1.2667
107 I B 0.2229
108 K B -1.1758
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4685 6.5556 View CSV PDB
4.5 -0.511 6.4662 View CSV PDB
5.0 -0.5626 6.3702 View CSV PDB
5.5 -0.6153 6.2719 View CSV PDB
6.0 -0.66 6.1729 View CSV PDB
6.5 -0.6896 6.074 View CSV PDB
7.0 -0.7032 5.9759 View CSV PDB
7.5 -0.7058 5.8805 View CSV PDB
8.0 -0.7018 5.7928 View CSV PDB
8.5 -0.6919 5.7226 View CSV PDB
9.0 -0.6757 5.679 View CSV PDB