Project name: ok 7

Status: done

Started: 2026-03-17 06:56:19
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCSASQSVSYMNWYKQKPGLAPRLLIYDTSKLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:07)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:08)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:00)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/96bc6942c13736f/tmp/folded.pdb                (00:04:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:04)
Show buried residues

Minimal score value
-3.3689
Maximal score value
1.2044
Average score
-0.7671
Total score value
-183.346

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8529
2 I A 0.0000
3 V A 0.9612
4 L A 0.0000
5 T A -0.0554
6 Q A 0.0000
7 S A -0.4697
8 P A -0.3572
9 A A -0.4153
10 T A -0.5968
11 L A -0.4940
12 S A -0.9554
13 L A -1.1918
14 S A -1.6979
15 P A -2.0271
16 G A -2.2795
17 E A -2.9764
18 R A -3.3007
19 A A 0.0000
20 T A -0.5613
21 L A 0.0000
22 S A -0.6553
23 C A 0.0000
24 S A -0.8864
25 A A 0.0000
26 S A -0.7090
27 Q A -1.5684
28 S A -1.2986
29 V A 0.0000
30 S A -0.5068
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.7380
37 Q A 0.0000
38 K A -1.0817
39 P A -0.6102
40 G A -0.6466
41 L A -0.5217
42 A A 0.0000
43 P A 0.0000
44 R A -1.4815
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.5403
49 D A -1.1757
50 T A -0.9532
51 S A -1.1514
52 K A -1.6246
53 L A -0.7077
54 A A -0.4748
55 T A -0.2785
56 G A -0.6083
57 I A -0.5398
58 P A -0.9018
59 D A -1.8719
60 R A -1.8942
61 F A 0.0000
62 S A -0.8865
63 G A 0.0000
64 S A -1.0461
65 G A -1.1928
66 S A -1.1081
67 G A -1.2224
68 T A -1.5873
69 D A -2.2841
70 F A 0.0000
71 T A -0.7374
72 L A 0.0000
73 T A -0.8132
74 I A 0.0000
75 S A -2.4076
76 R A -3.3689
77 L A 0.0000
78 E A -2.5667
79 P A -1.7709
80 E A -2.5104
81 D A 0.0000
82 F A -1.1714
83 A A 0.0000
84 V A -0.5967
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0672
91 S A -0.2875
92 S A -1.2333
93 N A -1.7416
94 P A -1.5197
95 F A 0.0000
96 T A 0.0000
97 F A 0.2381
98 G A 0.0000
99 Q A -0.9099
100 G A 0.0000
101 T A 0.0000
102 K A -1.3346
103 L A 0.0000
104 E A -1.6186
105 I A -1.2064
106 K A -2.0507
107 G A -1.5587
108 G A -1.3753
109 G A -1.3053
110 G A -1.3721
111 S A -1.0005
112 G A -1.4813
113 G A -1.6056
114 G A -1.3909
115 G A -1.3552
116 S A -1.1483
117 G A -1.1409
118 G A -1.2521
119 G A -1.3123
120 G A -1.5022
121 S A -1.3508
122 Q A -1.8730
123 V A 0.0000
124 Q A -1.6430
125 L A 0.0000
126 V A -0.0493
127 Q A 0.0000
128 S A -0.6195
129 G A -0.5946
130 A A 0.0336
131 E A 0.0597
132 V A 1.0159
133 Q A -0.7628
134 K A -2.0794
135 P A -2.1494
136 G A -1.4957
137 A A -1.1790
138 S A -1.3483
139 V A 0.0000
140 K A -2.0846
141 V A 0.0000
142 S A -0.6841
143 C A 0.0000
144 K A -0.9890
145 A A 0.0000
146 S A -0.9537
147 G A -1.1076
148 Y A -0.8100
149 T A -0.8550
150 F A 0.0000
151 N A -2.3471
152 R A -2.4949
153 Y A -1.3186
154 T A -0.7598
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.4115
161 A A -0.7837
162 P A -0.7517
163 G A -1.3317
164 Q A -1.4436
165 L A 0.0000
166 L A -0.3249
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.4750
171 I A 0.0000
172 N A -0.8802
173 P A 0.0000
174 S A -1.9556
175 R A -1.7926
176 G A -0.6770
177 Y A 0.5825
178 Y A 1.2044
179 N A 0.0627
180 Y A -1.0722
181 A A -1.8835
182 Q A -2.8853
183 K A -2.9821
184 F A 0.0000
185 K A -3.3585
186 D A -3.1397
187 R A -2.1576
188 V A 0.0000
189 T A -0.9293
190 M A 0.0000
191 T A -0.2966
192 R A -1.1360
193 D A -1.1231
194 T A -0.9122
195 S A -0.5619
196 T A -0.6783
197 S A -0.9073
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7846
201 M A 0.0000
202 E A -1.5772
203 L A 0.0000
204 S A -1.2778
205 S A -1.2211
206 L A 0.0000
207 R A -2.8410
208 S A -2.2724
209 E A -2.4732
210 D A 0.0000
211 T A -0.8294
212 A A 0.0000
213 V A 0.1126
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1012
221 D A -2.4339
222 D A -2.4874
223 H A -1.5338
224 Y A -0.3479
225 C A 0.0000
226 L A 0.0000
227 D A -0.3947
228 Y A -0.3983
229 W A 0.0000
230 G A 0.0000
231 Q A -1.0626
232 G A -0.4472
233 T A 0.0000
234 T A 0.0613
235 V A 0.0000
236 T A -0.2384
237 V A 0.0000
238 S A -0.8375
239 S A -0.9696
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7695 1.7768 View CSV PDB
4.5 -0.814 1.7794 View CSV PDB
5.0 -0.8657 1.7864 View CSV PDB
5.5 -0.9153 1.8018 View CSV PDB
6.0 -0.953 1.8271 View CSV PDB
6.5 -0.9722 1.8591 View CSV PDB
7.0 -0.9737 1.8941 View CSV PDB
7.5 -0.9632 1.9301 View CSV PDB
8.0 -0.9455 1.9663 View CSV PDB
8.5 -0.9214 2.0022 View CSV PDB
9.0 -0.8899 2.0368 View CSV PDB