Project name: 96cfbc4f08d0cb3

Status: done

Started: 2026-03-13 10:26:11
Chain sequence(s) A: MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:11:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/96cfbc4f08d0cb3/tmp/folded.pdb                (00:11:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:17:22)
Show buried residues

Minimal score value
-4.0982
Maximal score value
3.3537
Average score
-0.9424
Total score value
-241.2472

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1061
2 R A -1.4504
3 P A -0.9658
4 A A -0.2062
5 A A 0.1414
6 L A 0.5929
7 R A -1.1332
8 G A -0.4562
9 A A 0.4629
10 L A 2.0087
11 L A 2.4561
12 G A 1.5982
13 C A 2.2978
14 L A 2.7996
15 C A 2.6232
16 L A 3.1659
17 A A 2.5452
18 L A 3.3537
19 L A 3.3286
20 C A 2.5282
21 L A 2.2596
22 G A 0.2600
23 G A -0.9019
24 A A -1.7319
25 D A -3.3677
26 K A -3.5244
27 R A -3.2805
28 L A -1.8214
29 R A -3.6257
30 D A -3.4105
31 N A -3.4167
32 H A -3.3219
33 E A -3.8302
34 W A 0.0000
35 K A -2.7492
36 K A -1.9067
37 L A 0.0000
38 I A 0.0000
39 M A 0.0000
40 V A 0.0000
41 Q A 0.0000
42 H A 0.0000
43 W A 0.0000
44 P A 0.0000
45 E A -1.4540
46 T A 0.0000
47 V A 0.0000
48 C A -1.3392
49 E A -2.4249
50 K A -2.1956
51 I A -0.6265
52 Q A -1.6856
53 N A -1.9654
54 D A -1.7999
55 C A 0.0000
56 R A -3.1295
57 D A -3.8158
58 P A 0.0000
59 P A -1.8222
60 D A -2.3453
61 Y A -0.6816
62 W A 0.0000
63 T A 0.0000
64 I A 0.0000
65 H A 0.0000
66 G A 0.0000
67 L A 0.0000
68 W A 0.0000
69 P A 0.0000
70 D A 0.0000
71 K A -2.8878
72 S A 0.0000
73 E A -2.3518
74 G A -2.1291
75 C A -2.1580
76 N A -1.9215
77 R A -2.4929
78 S A -1.2333
79 W A -0.8452
80 P A -1.1019
81 F A -1.3726
82 N A -1.5287
83 L A -1.8770
84 E A -2.9587
85 E A -2.6310
86 I A 0.0000
87 K A -3.3285
88 D A -3.0254
89 L A -1.9919
90 L A -1.6474
91 P A -1.5398
92 E A -1.4631
93 M A 0.0000
94 R A -2.0392
95 A A -1.0238
96 Y A -0.5633
97 W A 0.0000
98 P A 0.0000
99 D A 0.0000
100 V A 0.0000
101 I A 0.0000
102 H A -1.4932
103 S A 0.0000
104 F A -1.0224
105 P A -1.2652
106 N A -1.9325
107 R A -2.0858
108 S A -1.8236
109 R A -2.4680
110 F A 0.0000
111 W A 0.0000
112 K A -2.2966
113 H A -1.8020
114 E A 0.0000
115 W A 0.0000
116 E A -2.5744
117 K A -2.4312
118 H A 0.0000
119 G A 0.0000
120 T A 0.0000
121 C A 0.0000
122 A A 0.0000
123 A A -1.3716
124 Q A -2.0744
125 V A 0.0000
126 D A -2.7846
127 A A -2.0614
128 L A 0.0000
129 N A -1.9102
130 S A -1.5025
131 Q A 0.0000
132 K A -2.5967
133 K A -2.1898
134 Y A 0.0000
135 F A 0.0000
136 G A -1.5188
137 R A -1.4490
138 S A 0.0000
139 L A 0.0000
140 E A -2.5636
141 L A 0.0000
142 Y A 0.0000
143 R A -3.5367
144 E A -3.3620
145 L A 0.0000
146 D A -2.4745
147 L A 0.0000
148 N A -0.8881
149 S A -0.5287
150 V A -0.0915
151 L A 0.0000
152 L A 0.2506
153 K A -1.0434
154 L A -0.1673
155 G A -0.6248
156 I A 0.0000
157 K A -1.1525
158 P A -0.5371
159 S A 0.3168
160 I A 1.4819
161 N A 0.1494
162 Y A 0.5051
163 Y A -0.3914
164 Q A -1.8327
165 V A 0.0000
166 A A -1.9482
167 D A -1.5303
168 F A 0.0000
169 K A -1.6375
170 D A -2.0784
171 A A -1.2208
172 L A 0.0000
173 A A -0.9405
174 R A -1.8421
175 V A -0.1665
176 Y A 0.0901
177 G A -0.6312
178 V A 0.0000
179 I A 0.7628
180 P A 0.0000
181 K A 0.2298
182 I A 0.0000
183 Q A 0.0000
184 C A 0.0000
185 L A 0.1092
186 P A -0.8634
187 P A -1.7568
188 S A -2.1102
189 Q A -2.8533
190 D A -3.4643
191 E A -3.4810
192 E A -3.1146
193 V A 0.0000
194 Q A 0.0000
195 T A 0.0000
196 I A 0.0000
197 G A 0.0000
198 Q A 0.0000
199 I A 0.0000
200 E A 0.0000
201 L A 0.0000
202 C A 0.0000
203 L A 0.0000
204 T A -1.7782
205 K A -2.2797
206 Q A -3.0545
207 D A -2.9338
208 Q A 0.0000
209 Q A -1.7349
210 L A -0.3923
211 Q A -0.6627
212 N A -0.6740
213 C A -0.3584
214 T A -1.6964
215 E A -3.0382
216 P A -2.1586
217 G A -2.2873
218 E A -3.3620
219 Q A -2.8705
220 P A -2.1361
221 S A -1.6557
222 P A -1.4816
223 K A -1.9962
224 Q A -1.9009
225 E A -1.8138
226 V A -0.2796
227 W A -0.7634
228 L A -0.3956
229 A A -0.4165
230 N A -1.1928
231 G A -0.6464
232 A A -0.3159
233 A A -0.5127
234 E A -0.7038
235 S A -0.9089
236 R A -1.3183
237 G A -1.0245
238 L A 0.0000
239 R A -0.4628
240 V A 0.1358
241 C A -0.8397
242 E A -2.6347
243 D A -2.8573
244 G A -1.8923
245 P A -1.4646
246 V A 0.0000
247 F A 0.2382
248 Y A 0.0000
249 P A 0.0000
250 P A -0.9225
251 P A -2.2139
252 K A -3.6889
253 K A -4.0982
254 T A -3.0418
255 K A -3.1213
256 H A -2.0776
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6987 4.7256 View CSV PDB
4.5 -0.7796 4.7256 View CSV PDB
5.0 -0.8794 4.7256 View CSV PDB
5.5 -0.98 4.7256 View CSV PDB
6.0 -1.0614 4.7256 View CSV PDB
6.5 -1.1088 4.7256 View CSV PDB
7.0 -1.1201 4.7256 View CSV PDB
7.5 -1.1058 4.7256 View CSV PDB
8.0 -1.0766 4.7256 View CSV PDB
8.5 -1.0358 4.7256 View CSV PDB
9.0 -0.9822 4.7256 View CSV PDB