Project name: 96f8d83f6a1569b

Status: done

Started: 2026-05-19 03:20:38
Chain sequence(s) A: SQQVEQSPQSLSIPEGENATMNCSYKTSINNLQWYRQDPGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITNARPADTASYFCATMGDSGYSTLTFGKGTMLTVTPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPKSVTLPEGESMTLQCAQDMNHEYMSWYRQDPGKGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAQPSQTSVYFCASSPMGGSYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:10)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:10)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:10)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/96f8d83f6a1569b/tmp/folded.pdb                (00:04:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:26)
Show buried residues

Minimal score value
-3.8928
Maximal score value
1.5239
Average score
-0.917
Total score value
-228.3448

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -0.9601
2 Q A -1.6979
3 Q A -1.6948
4 V A 0.0000
5 E A -2.9283
6 Q A 0.0000
7 S A -1.4893
8 P A -1.1178
9 Q A -1.8350
10 S A -0.6568
11 L A -0.1209
12 S A -0.1460
13 I A -0.9546
14 P A -1.7859
15 E A -2.7097
16 G A -2.5134
17 E A -2.9500
18 N A -2.2279
19 A A 0.0000
20 T A -0.6490
21 M A 0.0000
22 N A -1.3660
23 C A 0.0000
24 S A -1.9462
25 Y A 0.0000
26 K A -2.6176
27 T A -1.4718
28 S A -1.2945
29 I A 0.0000
30 N A -1.8679
31 N A 0.0000
32 L A 0.0000
33 Q A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 R A -0.2525
37 Q A -0.6734
38 D A -0.9209
39 P A -1.0815
40 G A -1.4855
41 R A -1.8342
42 G A -0.8647
43 L A 0.0000
44 V A 0.3191
45 H A 0.3029
46 L A 0.3459
47 I A 0.0000
48 L A -0.2980
49 I A 0.0000
50 R A -2.2460
51 S A -1.9619
52 N A -2.5437
53 E A -2.8420
54 R A -3.6211
55 E A -3.8928
56 K A -2.8521
57 H A -2.3412
58 S A -1.2901
59 G A -1.2277
60 R A -1.5214
61 L A -1.2673
62 R A -2.1940
63 V A 0.0000
64 T A -2.1721
65 L A 0.0000
66 D A -2.3644
67 T A -1.9434
68 S A -1.4954
69 K A -2.5864
70 K A -2.3187
71 S A -1.8470
72 S A 0.0000
73 S A -0.8701
74 L A 0.0000
75 L A -0.7971
76 I A 0.0000
77 T A -1.6940
78 N A -2.4452
79 A A 0.0000
80 R A -2.3093
81 P A -1.0643
82 A A -0.5790
83 D A 0.0000
84 T A -0.3300
85 A A 0.0000
86 S A -0.4399
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 T A 0.0000
92 M A 0.0000
93 G A -1.3348
94 D A -2.2601
95 S A -1.2252
96 G A -0.9285
97 Y A 0.2499
98 S A 0.0856
99 T A 0.0766
100 L A 0.0000
101 T A -0.5190
102 F A 0.0000
103 G A 0.0000
104 K A -2.5834
105 G A -1.6216
106 T A 0.0000
107 M A -0.3056
108 L A 0.0000
109 T A -0.3033
110 V A 0.0000
111 T A -0.9308
112 P A -1.2560
113 G A -1.5884
114 G A -1.3400
115 G A -1.4490
116 S A -1.6613
117 E A -2.4912
118 G A -1.8188
119 G A -1.4509
120 G A -1.5814
121 S A -1.5618
122 E A -2.3628
123 G A -1.8114
124 G A -1.3520
125 G A -1.4211
126 S A -1.6757
127 E A -2.4575
128 G A -1.8543
129 G A -1.7513
130 G A -1.8392
131 S A -1.7142
132 E A -2.5089
133 G A -1.7888
134 G A -1.4678
135 T A -1.1056
136 G A -1.1953
137 N A -1.0705
138 A A -0.7813
139 G A -0.9337
140 V A 0.0000
141 T A -0.8257
142 Q A 0.0000
143 T A -0.9838
144 P A -1.2527
145 K A -2.2243
146 S A -1.5484
147 V A -0.6273
148 T A -0.4350
149 L A -0.8934
150 P A -1.6982
151 E A -2.8652
152 G A -2.1887
153 E A -2.1572
154 S A -1.2177
155 M A -0.4731
156 T A -0.7545
157 L A 0.0000
158 Q A -0.8650
159 C A 0.0000
160 A A -0.9634
161 Q A 0.0000
162 D A -2.3192
163 M A -1.3496
164 N A -1.9325
165 H A 0.0000
166 E A -0.7885
167 Y A 0.1659
168 M A 0.0000
169 S A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A -0.6268
173 Q A -0.9909
174 D A 0.0000
175 P A -0.9276
176 G A -1.5576
177 K A -2.0427
178 G A 0.0000
179 L A 0.0000
180 R A -1.3849
181 L A 0.0000
182 I A 0.0000
183 H A -1.5396
184 Y A -0.2086
185 S A 0.0000
186 V A 0.6338
187 G A 0.3593
188 A A 0.0226
189 G A 0.4090
190 I A 1.5239
191 T A -0.0947
192 D A -1.4351
193 Q A -2.4748
194 G A -1.9203
195 E A -2.1244
196 V A -1.3471
197 P A -1.8169
198 N A -1.7725
199 G A -1.1118
200 Y A 0.0000
201 N A -1.9071
202 V A -1.1916
203 S A -0.5962
204 R A 0.0000
205 S A -0.3560
206 T A -0.7542
207 T A -1.3304
208 E A -1.9330
209 D A -1.3195
210 F A 0.0000
211 P A -0.8737
212 L A 0.0000
213 R A -1.7020
214 L A 0.0000
215 L A -0.6870
216 S A -1.2553
217 A A 0.0000
218 Q A -1.7721
219 P A -1.1526
220 S A -0.7375
221 Q A 0.0000
222 T A -0.5857
223 S A 0.0000
224 V A -0.6610
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 P A -0.1027
232 M A 0.4664
233 G A -0.2221
234 G A -0.5163
235 S A -0.2526
236 Y A 0.0477
237 E A -0.3120
238 Q A 0.0000
239 Y A 0.4350
240 F A 0.0000
241 G A 0.0000
242 P A -1.2837
243 G A 0.0000
244 T A 0.0000
245 R A -2.1832
246 L A 0.0000
247 T A -0.7259
248 V A 0.0000
249 T A -0.8631
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7011 2.8634 View CSV PDB
4.5 -0.7489 2.8175 View CSV PDB
5.0 -0.8113 2.7586 View CSV PDB
5.5 -0.8778 2.6936 View CSV PDB
6.0 -0.936 2.6265 View CSV PDB
6.5 -0.9741 2.5587 View CSV PDB
7.0 -0.9884 2.4908 View CSV PDB
7.5 -0.9855 2.4232 View CSV PDB
8.0 -0.9739 2.357 View CSV PDB
8.5 -0.9571 2.2947 View CSV PDB
9.0 -0.936 2.242 View CSV PDB