Project name: 59a449006165df7 [mutate: DQ221A]

Status: done

Started: 2026-05-19 03:33:56
Chain sequence(s) A: SQQVEQSPQSLTVPEGENATLNCSYKTSINNLQWYRQDPGRGLVFLILIRSNEREKHSGRLTVTLDTSKKSSSLLITNARPADTALYFCATMGDSGYSTLTFGKGTMLTVTPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPKSVTLPEGESMTLQCSQDMNHEYMLWYRQDPGKGLRLIHYSVGAGITDQGEVPEGYNVSRSTTEDFPLRLLSAQPSDTSVYFCASSPMGGSYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues DQ221A
Energy difference between WT (input) and mutated protein (by FoldX) 1.11341 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:07)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/980bf6444cc7e92/tmp/folded.pdb                (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)
Show buried residues

Minimal score value
-3.8278
Maximal score value
1.7596
Average score
-0.8835
Total score value
-219.9875

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -0.7256
2 Q A -1.3134
3 Q A -1.4749
4 V A 0.0000
5 E A -2.0210
6 Q A 0.0000
7 S A -1.1859
8 P A -0.9865
9 Q A -1.3811
10 S A -0.5201
11 L A -0.0819
12 T A -0.1206
13 V A 0.0000
14 P A -2.1473
15 E A -3.2595
16 G A -3.0612
17 E A -3.4462
18 N A -2.8771
19 A A 0.0000
20 T A -0.3739
21 L A 0.0000
22 N A -1.1089
23 C A 0.0000
24 S A -1.7115
25 Y A 0.0000
26 K A -2.5075
27 T A -1.3945
28 S A -1.2840
29 I A 0.0000
30 N A -1.9428
31 N A 0.0000
32 L A 0.0000
33 Q A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 R A 0.2249
37 Q A -0.3874
38 D A -0.8925
39 P A -1.1792
40 G A -1.7482
41 R A -2.0865
42 G A -0.5755
43 L A 0.0000
44 V A 1.7596
45 F A 1.4668
46 L A 0.8792
47 I A 0.0000
48 L A -0.2838
49 I A 0.0000
50 R A -2.5466
51 S A -2.1342
52 N A -2.6865
53 E A -3.1209
54 R A -3.8095
55 E A -3.8278
56 K A -2.7979
57 H A -1.9402
58 S A -1.0044
59 G A -0.9150
60 R A -1.0987
61 L A -0.6341
62 T A -1.0549
63 V A 0.0000
64 T A -2.0040
65 L A 0.0000
66 D A -2.6884
67 T A -2.1291
68 S A -1.6009
69 K A -2.6828
70 K A -2.4022
71 S A 0.0000
72 S A 0.0000
73 S A -0.6240
74 L A 0.0000
75 L A -0.3449
76 I A 0.0000
77 T A -1.8198
78 N A -3.0785
79 A A 0.0000
80 R A -2.9862
81 P A -1.3588
82 A A -0.7431
83 D A 0.0000
84 T A -0.3524
85 A A 0.0000
86 L A -0.0378
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 T A 0.0000
92 M A 0.0000
93 G A -1.3490
94 D A -2.2499
95 S A -1.2089
96 G A -0.7482
97 Y A 0.1897
98 S A 0.0000
99 T A 0.0581
100 L A 0.0000
101 T A -0.3669
102 F A 0.0000
103 G A 0.0000
104 K A -1.4455
105 G A 0.0000
106 T A 0.0000
107 M A -0.0425
108 L A 0.0000
109 T A -0.3315
110 V A 0.0000
111 T A -1.2327
112 P A -1.4515
113 G A -1.8225
114 G A -1.4197
115 G A -1.5425
116 S A -1.6764
117 E A -2.5156
118 G A -1.8102
119 G A -1.4683
120 G A -1.4815
121 S A -1.5290
122 E A -2.3602
123 G A -1.7912
124 G A -1.3458
125 G A -1.4100
126 S A -1.6302
127 E A -2.4707
128 G A -1.8779
129 G A -1.8234
130 G A -1.8426
131 S A -1.7314
132 E A -2.5236
133 G A -1.8002
134 G A -1.6618
135 T A -1.2240
136 G A -1.3517
137 N A -1.8744
138 A A -0.9560
139 G A -1.0044
140 V A 0.0000
141 T A -0.8630
142 Q A 0.0000
143 T A -1.0457
144 P A -1.2958
145 K A -2.1882
146 S A -1.5076
147 V A -0.5313
148 T A -0.3268
149 L A -0.8383
150 P A -1.6585
151 E A -2.8539
152 G A -2.2159
153 E A -2.2737
154 S A -1.4319
155 M A 0.0000
156 T A -0.8796
157 L A 0.0000
158 Q A -0.9058
159 C A 0.0000
160 S A -1.1624
161 Q A 0.0000
162 D A -2.6387
163 M A -1.4444
164 N A -2.0657
165 H A -1.1974
166 E A -0.9159
167 Y A 0.0000
168 M A 0.0000
169 L A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A 0.0000
173 Q A -0.7775
174 D A -0.8813
175 P A -0.8915
176 G A -1.2206
177 K A -1.5455
178 G A 0.0000
179 L A 0.0000
180 R A -0.6709
181 L A 0.0000
182 I A 0.0000
183 H A -1.5001
184 Y A 0.0000
185 S A 0.0000
186 V A 0.4928
187 G A 0.2351
188 A A -0.0609
189 G A 0.3740
190 I A 1.4155
191 T A -0.1983
192 D A -1.4896
193 Q A -2.4467
194 G A -1.6686
195 E A -1.5624
196 V A -0.9612
197 P A -1.8482
198 E A -2.2858
199 G A -1.5787
200 Y A 0.0000
201 N A -2.0540
202 V A -1.1993
203 S A -0.5066
204 R A 0.0000
205 S A -0.4133
206 T A -0.8564
207 T A -1.5093
208 E A -2.2515
209 D A -1.5572
210 F A 0.0000
211 P A -0.9449
212 L A 0.0000
213 R A -1.8155
214 L A 0.0000
215 L A -0.9259
216 S A -1.4201
217 A A 0.0000
218 Q A -1.7930
219 P A -1.1397
220 S A -0.8119
221 Q A -0.7312 mutated: DQ221A
222 T A -0.6254
223 S A 0.0000
224 V A -0.6736
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 P A -0.0291
232 M A 0.5507
233 G A 0.0520
234 G A -0.3467
235 S A -0.3184
236 Y A 0.1641
237 E A 0.3399
238 Q A 0.0000
239 Y A 1.1729
240 F A 0.6809
241 G A 0.0000
242 P A -0.9863
243 G A 0.0000
244 T A 0.0000
245 R A -2.1468
246 L A 0.0000
247 T A -0.6325
248 V A -0.8962
249 T A -0.7567
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6144 2.7293 View CSV PDB
4.5 -0.6675 2.6834 View CSV PDB
5.0 -0.7341 2.6236 View CSV PDB
5.5 -0.8031 2.5574 View CSV PDB
6.0 -0.863 2.4887 View CSV PDB
6.5 -0.9043 2.4193 View CSV PDB
7.0 -0.9236 2.3498 View CSV PDB
7.5 -0.9262 2.2806 View CSV PDB
8.0 -0.9193 2.2127 View CSV PDB
8.5 -0.9059 2.1486 View CSV PDB
9.0 -0.8868 2.0939 View CSV PDB