Project name: 982d055ea7ae9d6

Status: done

Started: 2026-07-14 14:46:26
Chain sequence(s) A: QVQLVQSGGGTVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVSVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQIT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:52)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/982d055ea7ae9d6/tmp/folded.pdb                (00:03:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:19)
Show buried residues

Minimal score value
-3.2747
Maximal score value
0.6559
Average score
-0.7437
Total score value
-178.4907

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.3300
2 V A -0.5691
3 Q A -0.6424
4 L A 0.0000
5 V A 0.4200
6 Q A 0.0000
7 S A -0.7010
8 G A -1.0082
9 G A -0.8454
10 G A -0.6434
11 T A -0.4724
12 V A -1.2567
13 Q A -2.2465
14 P A -2.3230
15 G A -2.2081
16 R A -2.7704
17 S A -2.1370
18 L A -1.4787
19 R A -2.0105
20 L A 0.0000
21 S A -0.6802
22 C A 0.0000
23 K A -1.1868
24 A A 0.0000
25 S A -0.8635
26 G A -0.8455
27 Y A -0.5760
28 T A -0.6557
29 F A 0.0000
30 T A -1.4895
31 R A -1.9633
32 Y A -0.9705
33 T A -0.5843
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.4745
39 Q A -0.7937
40 A A -1.2233
41 P A -1.1850
42 G A -1.4473
43 K A -2.3497
44 G A -1.5633
45 L A 0.0000
46 E A -0.8160
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 Y A 0.0425
51 I A 0.0000
52 N A -0.8100
53 P A 0.0000
54 S A -1.4705
55 R A -1.6234
56 G A -0.6348
57 Y A 0.4479
58 T A 0.0720
59 N A -0.8109
60 Y A -1.4693
61 N A -1.9257
62 Q A -2.6885
63 K A -2.9274
64 V A 0.0000
65 K A -3.2747
66 D A -3.1690
67 R A -2.1793
68 F A 0.0000
69 T A -1.1167
70 I A 0.0000
71 S A -0.4617
72 R A -1.6336
73 D A -1.8584
74 N A -1.8549
75 S A -1.6705
76 K A -2.6466
77 N A -2.1039
78 T A 0.0000
79 A A 0.0000
80 F A -0.7173
81 L A 0.0000
82 Q A -1.1882
83 M A 0.0000
84 D A -2.2455
85 S A -2.0340
86 L A 0.0000
87 R A -2.5747
88 P A -1.9382
89 E A -2.3403
90 D A 0.0000
91 T A -0.9472
92 G A 0.0000
93 V A 0.0505
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 Y A -0.3581
100 Y A -1.0848
101 D A -2.5369
102 D A -2.4934
103 H A -1.4080
104 Y A -0.4593
105 C A 0.0000
106 L A 0.0000
107 D A -0.1207
108 Y A 0.2434
109 W A -0.2534
110 G A 0.0000
111 Q A -1.3287
112 G A -0.7893
113 T A 0.0000
114 P A -0.4163
115 V A 0.0000
116 S A -0.7818
117 V A 0.0000
118 S A -1.3004
119 S A -1.4076
120 G A -1.2262
121 G A -1.1009
122 G A -1.1630
123 G A -1.1449
124 S A -0.9141
125 G A -1.1312
126 G A -1.1750
127 G A -1.1579
128 G A -1.1711
129 S A -1.0040
130 G A -1.3317
131 G A -1.4928
132 G A -1.1907
133 G A -1.0947
134 S A -0.9277
135 D A -1.3758
136 I A -1.0494
137 Q A -1.3899
138 M A 0.0000
139 T A -0.8754
140 Q A 0.0000
141 S A -0.5994
142 P A -0.6126
143 S A -0.8546
144 S A -0.8744
145 L A -0.4453
146 S A -0.4506
147 A A -0.3285
148 S A -0.0492
149 V A 0.6559
150 G A -0.6866
151 D A -1.5469
152 R A -2.2520
153 V A 0.0000
154 T A -0.6040
155 I A 0.0000
156 T A -0.5697
157 C A 0.0000
158 S A -1.1793
159 A A 0.0000
160 S A -1.0202
161 S A -0.8363
162 S A -0.6516
163 V A 0.0000
164 S A -0.0189
165 Y A 0.5527
166 M A 0.0000
167 N A 0.0000
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 T A -1.2170
173 P A -0.9594
174 G A -1.4986
175 K A -2.4623
176 A A -1.5413
177 P A 0.0000
178 K A -1.5675
179 R A -0.6758
180 W A -0.5363
181 I A 0.0000
182 Y A -0.0258
183 D A 0.0000
184 T A 0.0000
185 S A -0.6220
186 K A -1.0130
187 L A -0.2854
188 A A 0.0000
189 S A -0.4769
190 G A -0.5315
191 V A 0.0000
192 P A -0.3881
193 S A -0.4310
194 R A -0.7659
195 F A 0.0000
196 S A -0.4963
197 G A 0.0000
198 S A -0.8268
199 G A -1.1103
200 S A -0.9713
201 G A -0.9271
202 T A -1.2222
203 D A -2.1667
204 Y A 0.0000
205 T A -0.7037
206 F A 0.0000
207 T A -0.5761
208 I A 0.0000
209 S A -1.2733
210 S A -1.0661
211 L A 0.0000
212 Q A -0.6501
213 P A -0.8476
214 E A -1.8417
215 D A 0.0000
216 I A -0.5785
217 A A 0.0000
218 T A -0.6771
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 Q A 0.0000
223 Q A 0.0000
224 W A 0.1017
225 S A -0.1603
226 S A -0.7551
227 N A -1.3487
228 P A -1.2113
229 F A 0.0000
230 T A -0.7212
231 F A 0.0000
232 G A 0.0000
233 Q A -1.6003
234 G A 0.0000
235 T A 0.0000
236 K A -1.4376
237 L A 0.0000
238 Q A -0.4965
239 I A 0.2178
240 T A 0.2299
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8198 1.7308 View CSV PDB
4.5 -0.8543 1.6521 View CSV PDB
5.0 -0.8918 1.6521 View CSV PDB
5.5 -0.9262 1.6521 View CSV PDB
6.0 -0.9508 1.6521 View CSV PDB
6.5 -0.9608 1.6521 View CSV PDB
7.0 -0.9577 1.6521 View CSV PDB
7.5 -0.9467 1.6521 View CSV PDB
8.0 -0.9308 1.6521 View CSV PDB
8.5 -0.9094 1.6521 View CSV PDB
9.0 -0.8806 1.6521 View CSV PDB