Project name: 468718088117aa1 [mutate: GS35A, AS49A, AS75A, KR87A] [mutate: AP14A, RY59A, HN84A] [mutate: YR59A] [mutate: MT78A, PA88A, QL120A] [mutate: RY59A] [mutate: AP88A]

Status: done

Started: 2026-03-06 13:53:28
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMSWFRQAPGKEREFVSAISRSAGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAATLQSTVVLSTHNYDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Mutated residues AP88A
Energy difference between WT (input) and mutated protein (by FoldX) 4.27991 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:01:27)
[INFO]       CABS:     Running CABS flex simulation                                                (00:01:30)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:26:48)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:26:49)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:26:49)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:26:50)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:26:51)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:26:51)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:26:52)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:26:53)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:26:53)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:26:54)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:26:55)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:26:56)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:26:56)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:27:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:27:03)
Show buried residues

Minimal score value
-2.324
Maximal score value
1.9727
Average score
-0.1156
Total score value
-14.4533

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8199
2 V A 0.0000
3 Q A -1.1983
4 L A 0.0000
5 V A 0.9770
6 E A -0.0184
7 S A -0.1998
8 G A -0.2832
9 G A -0.5872
10 G A -0.5548
11 L A 0.0000
12 V A 1.7656
13 Q A 0.0000
14 P A -0.1512
15 G A -0.5667
16 G A -0.5950
17 S A -0.4097
18 L A 0.0000
19 R A -1.8961
20 L A 0.0000
21 S A -0.0044
22 C A 0.0000
23 A A 0.0244
24 A A 0.0000
25 S A -0.1377
26 G A -0.6950
27 R A -1.9066
28 T A 0.0000
29 F A 0.0000
30 S A -0.1674
31 S A -0.0620
32 Y A 0.0000
33 A A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 F A 0.5068
38 R A 0.0000
39 Q A -0.6368
40 A A 0.0000
41 P A -0.4236
42 G A -0.6631
43 K A -1.2318
44 E A -2.3240
45 R A -2.2478
46 E A 0.0000
47 F A 1.9727
48 V A 0.0000
49 S A 0.0000
50 A A 0.0144
51 I A 0.0000
52 S A 0.0000
53 R A -0.2491
54 S A -0.1555
55 A A -0.0651
56 G A -0.4616
57 T A -0.1145
58 T A 0.1533
59 Y A 1.1406
60 Y A 1.4952
61 A A 0.1679
62 D A -0.7415
63 S A 0.1325
64 V A 1.7624
65 K A 0.0000
66 G A -0.6350
67 R A -1.8976
68 F A 0.0000
69 T A -0.0599
70 I A 0.0000
71 S A -0.0776
72 R A -0.2271
73 D A 0.0000
74 N A -0.8200
75 S A -0.6834
76 K A -1.8189
77 N A -0.7377
78 T A -0.0863
79 L A 0.0000
80 Y A 0.4912
81 L A 0.0000
82 Q A -0.6369
83 M A 0.0000
84 N A -0.6792
85 S A 0.0000
86 L A 1.5477
87 R A 0.0000
88 P A -0.2549 mutated: AP88A
89 E A 0.0000
90 D A -1.7932
91 T A -0.3542
92 A A 0.0000
93 V A 0.3714
94 Y A 0.0000
95 Y A 0.0720
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 T A 0.0312
101 L A 0.0416
102 Q A -1.1606
103 S A -0.2937
104 T A 0.2667
105 V A 1.8586
106 V A 1.4772
107 L A 1.1768
108 S A 0.1295
109 T A -0.2291
110 H A -1.1293
111 N A -0.6599
112 Y A 1.0685
113 D A -0.3280
114 Y A 0.0000
115 W A 1.1644
116 G A 0.1250
117 Q A -0.5868
118 G A -0.3267
119 T A 0.2424
120 L A 1.5462
121 V A 0.0000
122 T A 0.1505
123 V A 0.1655
124 S A -0.1979
125 S A -0.2508
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.1156 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
input -0.1156 View CSV PDB
model_8 -0.1428 View CSV PDB
model_10 -0.156 View CSV PDB
model_0 -0.1729 View CSV PDB
model_1 -0.1747 View CSV PDB
model_3 -0.1893 View CSV PDB
CABS_average -0.1931 View CSV PDB
model_9 -0.1984 View CSV PDB
model_6 -0.2048 View CSV PDB
model_5 -0.2063 View CSV PDB
model_2 -0.2068 View CSV PDB
model_7 -0.2132 View CSV PDB
model_4 -0.2258 View CSV PDB
model_11 -0.226 View CSV PDB