Project name: 98a8c971d87a553

Status: done

Started: 2026-06-04 11:18:08
Chain sequence(s) A: SAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/98a8c971d87a553/tmp/folded.pdb                (00:06:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:50)
Show buried residues

Minimal score value
-4.1347
Maximal score value
1.5748
Average score
-1.5114
Total score value
-376.3358

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -1.8393
2 A A -2.4134
3 K A -3.7712
4 D A -4.0305
5 Q A -3.5908
6 L A 0.0000
7 K A -4.1347
8 Q A -3.5651
9 R A -3.3155
10 V A 0.0000
11 Q A -3.3095
12 K A -3.7509
13 L A 0.0000
14 Q A -2.5851
15 E A -3.8446
16 K A -3.7179
17 V A 0.0000
18 S A -2.3423
19 Q A -2.9807
20 Q A -2.8501
21 I A 0.0000
22 A A -1.3603
23 Q A -1.9551
24 D A 0.0000
25 P A -1.1036
26 N A -1.4585
27 L A 0.0000
28 S A -0.6807
29 A A -0.3032
30 Q A -0.6095
31 Q A -0.2538
32 R A -0.2429
33 F A 1.3528
34 L A 1.5748
35 L A 0.7422
36 S A 0.0747
37 H A -0.1169
38 A A -0.2945
39 V A 0.0000
40 Y A -0.2710
41 E A -2.3486
42 D A -2.5523
43 I A 0.0000
44 S A -1.9952
45 H A -2.6508
46 V A 0.0000
47 Q A -2.5918
48 D A -2.6375
49 T A -1.2890
50 I A 0.0000
51 S A -1.6743
52 T A -0.7295
53 L A -0.6934
54 D A -1.9277
55 P A -1.6601
56 S A -1.0608
57 A A -1.0841
58 A A 0.0000
59 N A -1.8037
60 Q A -2.0087
61 V A -1.1289
62 V A 0.0000
63 D A -2.7864
64 Q A -2.7670
65 A A -2.2436
66 A A -2.2062
67 Q A -2.6521
68 Q A -2.5788
69 L A 0.0000
70 Q A -2.1013
71 S A -1.8287
72 A A -1.4363
73 L A 0.0000
74 K A -2.6798
75 Q A -2.3915
76 V A -1.4332
77 S A -1.9704
78 A A -2.0243
79 Q A -2.3185
80 N A -2.1685
81 K A -2.5102
82 P A -1.6590
83 A A -1.6935
84 S A -1.7701
85 A A -2.1744
86 K A -3.3801
87 D A -3.2068
88 Q A -3.2495
89 L A 0.0000
90 K A -3.9888
91 Q A -3.6553
92 R A -3.3806
93 V A 0.0000
94 Q A -3.4020
95 K A -3.8463
96 L A 0.0000
97 Q A -2.6157
98 E A -3.8537
99 K A -3.5894
100 V A 0.0000
101 S A -2.3211
102 Q A -2.9229
103 Q A -2.7883
104 I A 0.0000
105 A A -1.3204
106 Q A -1.9394
107 D A 0.0000
108 P A -1.0862
109 N A -1.4420
110 L A 0.0000
111 S A -0.6620
112 A A -0.2792
113 Q A -0.5825
114 Q A -0.2349
115 R A -0.2097
116 F A 1.4177
117 L A 1.5385
118 L A 0.7219
119 S A 0.0592
120 H A -0.1849
121 A A -0.3430
122 V A 0.0000
123 Y A -0.3191
124 E A -2.3655
125 D A -2.5660
126 I A 0.0000
127 S A -1.9648
128 H A -2.6072
129 V A 0.0000
130 Q A -2.4098
131 D A -2.5558
132 T A -1.2353
133 I A 0.0000
134 S A -1.6181
135 T A -0.7016
136 L A -0.6987
137 D A -1.9396
138 P A -1.6643
139 S A -1.0818
140 A A -1.0370
141 A A 0.0000
142 N A -1.6911
143 Q A -1.8021
144 V A -0.9198
145 V A 0.0000
146 D A -2.1789
147 Q A -2.4656
148 A A -2.0744
149 A A -2.0159
150 Q A -2.5444
151 Q A -2.5488
152 L A 0.0000
153 Q A -2.2061
154 S A -1.9636
155 A A -1.5092
156 L A 0.0000
157 K A -2.7260
158 Q A -2.4234
159 V A -1.4422
160 S A -1.9614
161 A A -2.0164
162 Q A -2.3235
163 N A -2.1738
164 K A -2.5131
165 P A -1.6347
166 A A -1.6069
167 S A -1.6867
168 A A -2.0420
169 K A -3.2207
170 D A -3.0744
171 Q A -2.9487
172 L A 0.0000
173 K A -3.8537
174 Q A -3.4023
175 R A -3.2194
176 V A 0.0000
177 Q A -3.3979
178 K A -3.8700
179 L A 0.0000
180 Q A -2.6709
181 E A -3.9406
182 K A -3.8096
183 V A 0.0000
184 S A -2.3209
185 Q A -2.8859
186 Q A -2.7942
187 I A 0.0000
188 A A -1.3201
189 Q A -1.9124
190 D A 0.0000
191 P A -1.0568
192 N A -1.4250
193 L A 0.0000
194 S A -0.6824
195 A A -0.3354
196 Q A -0.6218
197 Q A -0.2476
198 R A -0.2399
199 F A 1.3344
200 L A 1.5060
201 L A 0.7152
202 S A 0.0693
203 H A -0.1537
204 A A -0.3420
205 V A 0.0000
206 Y A -0.3086
207 E A -2.3875
208 D A -2.6234
209 I A 0.0000
210 S A -2.0320
211 H A -2.6682
212 V A 0.0000
213 Q A -2.5750
214 D A -2.6287
215 T A -1.2800
216 I A 0.0000
217 S A -1.6560
218 T A -0.7250
219 L A -0.7063
220 D A -1.9316
221 P A -1.6132
222 S A -1.0652
223 A A -1.0775
224 A A 0.0000
225 N A -1.7414
226 Q A -1.9686
227 V A -1.0902
228 V A 0.0000
229 D A -2.6838
230 Q A -2.7192
231 A A -2.2292
232 A A -2.1979
233 Q A -2.6442
234 Q A -2.5830
235 L A 0.0000
236 Q A -2.1504
237 S A -1.8642
238 A A -1.4530
239 L A 0.0000
240 K A -2.6860
241 Q A -2.3947
242 V A -1.4202
243 S A -1.9477
244 A A -2.0205
245 Q A -2.3190
246 N A -2.1574
247 K A -2.4830
248 P A -1.3543
249 A A -0.6690
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.3801 3.0818 View CSV PDB
4.5 -1.4536 3.0874 View CSV PDB
5.0 -1.5337 3.103 View CSV PDB
5.5 -1.5987 3.1382 View CSV PDB
6.0 -1.6308 3.194 View CSV PDB
6.5 -1.627 3.2506 View CSV PDB
7.0 -1.5957 3.2872 View CSV PDB
7.5 -1.5469 3.3037 View CSV PDB
8.0 -1.4863 3.3097 View CSV PDB
8.5 -1.4135 3.3117 View CSV PDB
9.0 -1.3258 3.3123 View CSV PDB