Project name: f93310d4f63f343 [mutate: YK49A]

Status: done

Started: 2026-04-11 12:48:46
Chain sequence(s) A: GNKVEQSPQTLSVPEGASVTINCTYTDSSSTYLYWYKQEPGKGLQLLMYIFSNMDMKRKGRLTVLLNRKDKRLSLIIADVQPEDSAIYFCAESPPNYGGSQGNLIFGKGTKLTVKPGGGSEGGGSEGGGSEGGGSEGGTGDSGVTQTPKHLKVPEGARVTLRCRPRSGDLSVYWYRQDPGKGLIFLIMYYNGEERARGNLPERFSVRQFPDLSSILILSNLEPGDSALYFCASSARDGPYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues YK49A
Energy difference between WT (input) and mutated protein (by FoldX) -0.116132 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:08)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/98ffd4afb279ae5/tmp/folded.pdb                (00:01:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:38)
Show buried residues

Minimal score value
-3.4411
Maximal score value
0.6587
Average score
-0.9835
Total score value
-248.8361

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.1589
2 N A -1.5514
3 K A -2.0742
4 V A 0.0000
5 E A -2.4893
6 Q A 0.0000
7 S A -1.3488
8 P A -1.2197
9 Q A -1.8438
10 T A -0.7989
11 L A -0.2251
12 S A -0.5599
13 V A -0.7630
14 P A -1.8132
15 E A -2.5343
16 G A -2.0810
17 A A -1.2226
18 S A -1.0077
19 V A 0.0000
20 T A 0.0084
21 I A 0.0000
22 N A -0.9494
23 C A 0.0000
24 T A -1.8339
25 Y A 0.0000
26 T A -1.4702
27 D A -0.9314
28 S A -1.0238
29 S A -0.2943
30 S A 0.0000
31 T A 0.0196
32 Y A 0.3236
33 L A 0.0000
34 Y A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 K A -0.7508
38 Q A 0.0000
39 E A -1.9586
40 P A -1.2357
41 G A -1.7653
42 K A -2.1689
43 G A -1.3788
44 L A 0.0000
45 Q A -1.5262
46 L A -0.3850
47 L A -0.3102
48 M A 0.0000
49 K A -0.1812 mutated: YK49A
50 I A 0.0000
51 F A 0.4262
52 S A -0.5242
53 N A -1.2309
54 M A -0.8398
55 D A -1.6975
56 M A -0.6927
57 K A -1.5839
58 R A -2.8670
59 K A -3.0420
60 G A -2.0415
61 R A -2.0025
62 L A -1.5630
63 T A 0.0000
64 V A 0.0000
65 L A -0.4509
66 L A 0.0000
67 N A -2.5398
68 R A -3.1020
69 K A -3.2580
70 D A -3.2825
71 K A -2.7098
72 R A -2.5076
73 L A 0.0000
74 S A 0.0000
75 L A 0.0000
76 I A -0.0322
77 I A 0.0000
78 A A -1.2449
79 D A -2.4315
80 V A 0.0000
81 Q A -2.2525
82 P A -1.9638
83 E A -2.2543
84 D A 0.0000
85 S A -1.2205
86 A A 0.0000
87 I A -0.2659
88 Y A 0.0000
89 F A 0.0000
90 C A 0.0000
91 A A 0.0000
92 E A 0.0000
93 S A 0.0000
94 P A 0.0000
95 P A -0.1616
96 N A -0.3501
97 Y A 0.6587
98 G A -0.1721
99 G A -0.5422
100 S A -0.9258
101 Q A -1.1423
102 G A 0.0000
103 N A 0.0000
104 L A 0.0000
105 I A -0.2298
106 F A 0.0000
107 G A 0.0000
108 K A -2.3477
109 G A 0.0000
110 T A 0.0000
111 K A -0.9254
112 L A 0.0000
113 T A -0.9284
114 V A 0.0000
115 K A -2.4210
116 P A -2.0947
117 G A -1.7994
118 G A -1.6214
119 G A -1.5662
120 S A -1.6741
121 E A -2.4935
122 G A -1.8027
123 G A -1.3830
124 G A -1.5710
125 S A -1.5456
126 E A -2.3566
127 G A -1.7798
128 G A -1.3537
129 G A -1.3304
130 S A -1.5374
131 E A -2.4168
132 G A -1.7668
133 G A -1.5800
134 G A -1.7572
135 S A -1.6845
136 E A -2.5208
137 G A -1.7756
138 G A -1.8117
139 T A -1.2853
140 G A -1.8630
141 D A -2.3831
142 S A -1.3279
143 G A -1.1291
144 V A 0.0000
145 T A -1.0359
146 Q A 0.0000
147 T A -1.2579
148 P A -1.5425
149 K A -2.3253
150 H A -2.5132
151 L A -1.7264
152 K A -2.1762
153 V A -1.5897
154 P A -2.1352
155 E A -3.4411
156 G A -2.7602
157 A A -2.5192
158 R A -2.5574
159 V A 0.0000
160 T A -0.5402
161 L A 0.0000
162 R A -1.6170
163 C A 0.0000
164 R A -1.7382
165 P A 0.0000
166 R A -1.1191
167 S A -0.7851
168 G A -0.7965
169 D A 0.0000
170 L A -0.9446
171 S A 0.0000
172 V A 0.0000
173 Y A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 R A -0.3629
177 Q A 0.0000
178 D A -0.8740
179 P A -0.9635
180 G A -1.6780
181 K A -2.1276
182 G A 0.0000
183 L A 0.0000
184 I A -0.1100
185 F A 0.0000
186 L A 0.0000
187 I A 0.0000
188 M A 0.0000
189 Y A -1.4261
190 Y A -1.4786
191 N A -1.9860
192 G A -2.0439
193 E A -2.6729
194 E A -2.3241
195 R A -1.8956
196 A A -1.6870
197 R A -2.4817
198 G A -1.7161
199 N A -1.8997
200 L A -1.5093
201 P A -1.4430
202 E A -2.3106
203 R A -2.0320
204 F A 0.0000
205 S A -0.6788
206 V A 0.0000
207 R A -1.3477
208 Q A 0.0000
209 F A -0.4878
210 P A -0.9431
211 D A -1.8370
212 L A -1.1449
213 S A -1.2441
214 S A 0.0000
215 I A -0.5686
216 L A 0.0000
217 I A -0.5059
218 L A 0.0000
219 S A 0.0000
220 N A -2.9319
221 L A 0.0000
222 E A -2.8856
223 P A -1.7306
224 G A -1.3391
225 D A 0.0000
226 S A -1.0330
227 A A 0.0000
228 L A -0.6828
229 Y A 0.0000
230 F A 0.0000
231 C A 0.0000
232 A A 0.0000
233 S A 0.0000
234 S A 0.0000
235 A A -1.0655
236 R A -2.0237
237 D A -1.6205
238 G A 0.0000
239 P A 0.0000
240 Y A -0.4818
241 E A -0.6072
242 Q A 0.0000
243 Y A -0.3637
244 F A 0.0000
245 G A 0.0000
246 P A -1.3545
247 G A 0.0000
248 T A 0.0000
249 R A -2.4874
250 L A 0.0000
251 T A -1.5737
252 V A 0.0000
253 T A -1.3758
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7811 2.1852 View CSV PDB
4.5 -0.8357 1.9792 View CSV PDB
5.0 -0.902 1.7709 View CSV PDB
5.5 -0.9686 1.643 View CSV PDB
6.0 -1.0221 1.5921 View CSV PDB
6.5 -1.0512 1.5528 View CSV PDB
7.0 -1.0545 1.5254 View CSV PDB
7.5 -1.0399 1.506 View CSV PDB
8.0 -1.0154 1.4928 View CSV PDB
8.5 -0.9834 1.4887 View CSV PDB
9.0 -0.9447 1.668 View CSV PDB