Project name: HSA6A4_prot3D_74_015M

Status: done

Started: 2026-02-25 09:09:07
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQTYDYHSASWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/99e75dfbedb1b7/tmp/folded.pdb                 (00:01:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:05)
Show buried residues

Minimal score value
-2.8488
Maximal score value
1.4875
Average score
-0.538
Total score value
-123.7362

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.0358
2 S A 0.0602
3 V A 1.3783
4 L A 0.0000
5 T A 0.0302
6 Q A -0.2728
7 P A -0.4454
8 P A -0.6140
9 S A -0.4728
11 V A -0.0377
12 S A -0.1492
13 G A 0.0000
14 A A -0.2266
15 P A -0.9525
16 G A -1.8253
17 Q A -2.5725
18 R A -2.6843
19 V A 0.0000
20 T A -0.5154
21 I A 0.0000
22 S A -0.3353
23 C A 0.0000
24 T A -0.2336
25 G A -0.0306
26 S A -0.2174
27 S A -0.5416
28 S A 0.0000
29 N A 0.0000
30 I A 0.0000
31 G A -0.8675
35 A A -0.2959
36 G A -0.5340
37 Y A 0.0826
38 D A -0.4996
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.3984
44 Q A 0.0000
45 L A -0.1943
46 P A -0.4287
47 G A -0.4001
48 T A -0.3935
49 A A -0.4620
50 P A 0.0000
51 K A -0.9619
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.2361
56 G A -1.2484
57 N A -1.0541
65 S A -1.3397
66 N A -2.0809
67 R A -2.1525
68 P A -1.3467
69 S A -0.8265
70 G A -0.7119
71 V A -0.8326
72 P A -1.2979
74 D A -2.1591
75 R A -1.5408
76 F A 0.0000
77 S A -0.9925
78 G A -0.8041
79 S A -0.6426
80 K A -1.0478
83 S A -0.8265
84 G A -0.9510
85 T A -0.7471
86 S A -0.6607
87 A A 0.0000
88 S A -0.4399
89 L A 0.0000
90 A A -0.5793
91 I A 0.0000
92 T A -1.9165
93 G A -1.8661
94 L A 0.0000
95 Q A -1.5518
96 A A -1.2282
97 E A -2.1856
98 D A 0.0000
99 E A -1.4934
100 A A 0.0000
101 D A -0.6923
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 T A 0.0000
107 Y A 0.5645
108 D A 0.0000
109 Y A 0.8909
110 H A -0.5265
113 S A -0.4249
114 A A 0.3010
115 S A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.5544
121 G A 0.0000
122 T A 0.0000
123 K A -0.7533
124 V A 0.0000
125 T A -0.1739
126 V A 0.3560
127 L A 1.4608
1 Q B -0.8616
2 V B 0.2332
3 Q B -0.4211
4 L B 0.0000
5 V B 0.6632
6 Q B 0.0160
7 S B -0.6758
8 G B -0.8882
9 G B -0.5599
11 G B 0.4236
12 V B 1.4875
13 V B 0.1136
14 Q B -1.6274
15 P B -2.3013
16 G B -2.2310
17 R B -2.8488
18 S B -1.9818
19 L B -1.2336
20 R B -2.0816
21 L B 0.0000
22 S B -0.5158
23 C B 0.0000
24 A B -0.2000
25 A B -0.1767
26 S B -0.3387
27 G B -0.3244
28 F B 0.0243
29 T B -0.4256
30 F B -0.1993
35 S B 0.2230
36 S B 0.6430
37 Y B 1.0715
38 G B 0.6673
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7406
45 A B -0.9859
46 P B -0.9493
47 G B -1.4665
48 K B -2.2193
49 G B -1.4240
50 L B 0.0000
51 E B -0.7370
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.5937
58 Y B 0.7246
59 D B -1.3645
62 G B -0.7718
63 S B -0.7393
64 N B -0.5025
65 K B -0.5158
66 Y B -0.0716
67 Y B -0.7519
68 A B 0.0000
69 D B -2.6703
70 S B -1.9595
71 V B 0.0000
72 K B -2.5572
74 G B -1.7669
75 R B -1.7146
76 F B 0.0000
77 T B -0.7820
78 I B 0.0000
79 S B -0.6274
80 R B -1.0401
81 D B -1.5323
82 N B -1.5622
83 S B -1.4936
84 K B -2.2080
85 N B -1.4641
86 T B -0.8945
87 L B 0.0000
88 Y B -0.4865
89 L B 0.0000
90 Q B -1.2144
91 M B 0.0000
92 N B -2.2710
93 S B -2.0353
94 L B 0.0000
95 R B -2.7146
96 A B -1.6067
97 E B -1.7070
98 D B 0.0000
99 T B -0.3264
100 A B 0.0000
101 V B 0.1559
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4647
107 D B 0.0000
108 G B -0.7222
109 S B -0.7470
110 P B -1.1875
112 R B -1.9678
113 G B -1.5928
114 G B 0.0000
115 M B 0.0000
116 D B -1.2353
117 V B -0.6652
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9485
121 G B -0.4650
122 T B 0.0000
123 T B 0.1004
124 V B 0.0000
125 T B 0.2768
126 V B 0.0000
127 S B -0.5129
128 S B -0.5179
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5171 2.3383 View CSV PDB
4.5 -0.5468 2.3181 View CSV PDB
5.0 -0.5793 2.2924 View CSV PDB
5.5 -0.6092 2.2656 View CSV PDB
6.0 -0.6313 2.2418 View CSV PDB
6.5 -0.6424 2.2249 View CSV PDB
7.0 -0.6447 2.216 View CSV PDB
7.5 -0.6422 2.2125 View CSV PDB
8.0 -0.6365 2.2113 View CSV PDB
8.5 -0.6266 2.2109 View CSV PDB
9.0 -0.6114 2.2107 View CSV PDB