Project name: 9a58a857042b27e

Status: done

Started: 2026-07-12 00:41:24
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGSSFTGYNMNWVRQAPGQGLEWMGAIDPYYGGTSYNQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGMEYWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCRSSQSLVHRNGNTYLHWYQQRPGQSPRLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPPLTFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:04)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9a58a857042b27e/tmp/folded.pdb                (00:02:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:09)
Show buried residues

Minimal score value
-3.2112
Maximal score value
1.4003
Average score
-0.6713
Total score value
-161.7807

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4910
2 V A -1.0592
3 Q A -1.2710
4 L A 0.0000
5 V A -0.0661
6 Q A 0.0000
7 S A -0.6630
8 G A -0.7025
9 A A -0.1453
10 E A -0.3083
11 V A 0.8190
12 K A -0.9459
13 K A -2.1942
14 P A -2.2153
15 G A -1.4958
16 S A -1.1989
17 S A -1.3172
18 V A 0.0000
19 K A -1.9892
20 V A 0.0000
21 S A -0.5002
22 C A 0.0000
23 K A -0.7800
24 A A 0.0000
25 S A -0.8961
26 G A -1.1735
27 S A -0.8166
28 S A -0.5916
29 F A 0.0000
30 T A -0.1245
31 G A -0.1435
32 Y A 0.2485
33 N A -0.3956
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.5910
40 A A -1.0212
41 P A -1.0433
42 G A -1.2137
43 Q A -1.7277
44 G A -1.0349
45 L A 0.0000
46 E A -0.5768
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 A A -0.4083
51 I A 0.0000
52 D A -0.2261
53 P A 0.0000
54 Y A 1.1114
55 Y A 1.4003
56 G A -0.1880
57 G A -0.2876
58 T A -0.3776
59 S A -0.2536
60 Y A -0.6119
61 N A -1.2894
62 Q A -2.5083
63 K A -2.7855
64 F A 0.0000
65 Q A -2.3658
66 G A -1.5834
67 R A -1.4689
68 V A 0.0000
69 T A -0.7370
70 I A 0.0000
71 T A -0.5612
72 A A -0.7585
73 D A -1.5934
74 E A -2.1272
75 S A -1.3353
76 T A -1.1193
77 S A -1.3374
78 T A 0.0000
79 A A 0.0000
80 Y A -0.3626
81 M A 0.0000
82 E A -1.3287
83 L A 0.0000
84 S A -1.0545
85 S A -1.0833
86 L A 0.0000
87 R A -2.7691
88 S A -2.3998
89 E A -2.6978
90 D A 0.0000
91 T A -0.7965
92 A A 0.0000
93 V A 0.1656
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1306
100 M A 0.0000
101 E A -0.2716
102 Y A -0.1850
103 W A -0.4104
104 G A 0.0000
105 Q A -1.4448
106 G A -0.7080
107 T A 0.0000
108 T A -0.0221
109 V A 0.0000
110 T A -0.3397
111 V A 0.0000
112 S A -1.3009
113 S A -1.6905
114 G A -1.2593
115 G A -1.1139
116 G A -1.1261
117 G A -1.1631
118 S A -0.9598
119 G A -1.3162
120 G A -1.4119
121 G A -1.3498
122 G A -1.3616
123 S A -1.0325
124 G A -1.3553
125 G A -1.6289
126 G A -1.1332
127 G A -1.3287
128 S A -0.7621
129 D A -0.6703
130 V A 0.0000
131 V A 0.9989
132 M A 0.0000
133 T A -0.3819
134 Q A 0.0000
135 S A -0.1847
136 P A 0.3375
137 L A 1.1317
138 S A 0.0221
139 L A -0.2363
140 P A -0.9281
141 V A 0.0000
142 T A -0.9779
143 L A -0.7766
144 G A -1.7658
145 Q A -2.1814
146 P A -1.9988
147 A A 0.0000
148 S A -0.7057
149 I A 0.0000
150 S A -0.8751
151 C A 0.0000
152 R A -2.3407
153 S A 0.0000
154 S A -0.8395
155 Q A -1.4459
156 S A -0.9223
157 L A 0.0000
158 V A -0.0103
159 H A -1.3744
160 R A -2.5546
161 N A -2.4238
162 G A -1.6114
163 N A -1.2739
164 T A -0.6380
165 Y A -0.2301
166 L A 0.0000
167 H A -0.6356
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 R A -1.4350
173 P A -1.0247
174 G A -1.4683
175 Q A -2.0861
176 S A -1.3374
177 P A 0.0000
178 R A -1.0721
179 L A 0.0000
180 L A 0.0000
181 I A 0.0000
182 H A -1.2425
183 K A -1.3661
184 V A 0.0000
185 S A -1.1966
186 N A -1.7269
187 R A -1.9830
188 F A -0.9662
189 S A -0.6170
190 G A -0.8224
191 V A -0.9166
192 P A -1.2212
193 D A -2.3767
194 R A -2.0646
195 F A 0.0000
196 S A -1.2826
197 G A 0.0000
198 S A -0.8312
199 G A -1.0680
200 S A -0.7273
201 G A -0.7629
202 T A -1.5175
203 D A -2.1762
204 F A 0.0000
205 T A -0.9972
206 L A 0.0000
207 K A -1.4540
208 I A 0.0000
209 S A -2.2771
210 R A -3.2112
211 V A 0.0000
212 E A -2.4014
213 A A -1.0366
214 E A -1.6138
215 D A 0.0000
216 V A -0.6790
217 G A 0.0000
218 V A -0.1642
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 S A 0.0000
223 Q A 0.0000
224 S A 0.1081
225 T A -0.0752
226 H A -0.0485
227 V A 0.9761
228 P A 0.2698
229 P A 0.0000
230 L A 0.0000
231 T A 0.3260
232 F A 0.2653
233 G A 0.0000
234 G A -0.3134
235 G A 0.0000
236 T A 0.0000
237 K A -0.6924
238 V A 0.0000
239 E A -1.2379
240 I A -0.1975
241 K A -1.3743
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6537 2.0672 View CSV PDB
4.5 -0.6852 2.0248 View CSV PDB
5.0 -0.7225 1.9804 View CSV PDB
5.5 -0.7577 1.9353 View CSV PDB
6.0 -0.7827 1.9178 View CSV PDB
6.5 -0.7918 1.9299 View CSV PDB
7.0 -0.7849 1.9342 View CSV PDB
7.5 -0.767 1.926 View CSV PDB
8.0 -0.7428 1.9111 View CSV PDB
8.5 -0.7139 1.8969 View CSV PDB
9.0 -0.6809 1.8878 View CSV PDB