Project name: 9b15f73cb2d1a85

Status: done

Started: 2026-08-10 12:32:26
Chain sequence(s) A: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9b15f73cb2d1a85/tmp/folded.pdb                (00:02:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:20)
Show buried residues

Minimal score value
-3.888
Maximal score value
3.7066
Average score
-1.0116
Total score value
-243.7966

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2372
2 N A -1.0425
3 R A -1.1094
4 C A 0.8582
5 W A 1.9385
6 A A 1.4820
7 L A 2.4463
8 F A 3.7066
9 L A 3.4734
10 S A 2.5898
11 L A 3.2981
12 C A 2.5736
13 C A 2.6282
14 Y A 3.3065
15 L A 2.6917
16 R A 0.8221
17 L A 2.3800
18 V A 2.3178
19 S A 0.3897
20 A A -0.2350
21 E A -1.5385
22 G A -1.7149
23 D A -2.1672
24 P A -1.2070
25 I A -0.8397
26 P A -1.8289
27 E A -2.6920
28 E A -2.8593
29 L A 0.0000
30 Y A -0.9789
31 E A -2.5254
32 M A -1.2791
33 L A -0.7950
34 S A -1.5458
35 D A -2.5773
36 H A -1.9929
37 S A -1.6509
38 I A -1.9051
39 R A -2.5236
40 S A -1.6037
41 F A -1.5128
42 D A -2.6489
43 D A -2.4103
44 L A 0.0000
45 Q A -2.1825
46 R A -3.3656
47 L A -1.3866
48 L A -1.4923
49 H A -2.4639
50 G A -2.1856
51 D A -3.3181
52 P A -2.6221
53 G A -3.1537
54 E A -3.7947
55 E A -3.8880
56 D A -3.6951
57 G A -2.4530
58 A A -1.5556
59 E A -1.6807
60 L A 0.1384
61 D A -0.9327
62 L A 0.2783
63 N A -0.5742
64 M A 0.1229
65 T A -0.6457
66 R A -1.9189
67 S A -1.5923
68 H A -1.8893
69 S A -1.5959
70 G A -1.4865
71 G A -1.7676
72 E A -1.8937
73 L A -0.2659
74 E A -1.1700
75 S A -0.3806
76 L A 0.6594
77 A A -0.7421
78 R A -2.4164
79 G A -2.6010
80 R A -3.3042
81 R A -2.9271
82 S A -1.1315
83 L A 0.6248
84 G A 0.1969
85 S A 0.6648
86 L A 2.0851
87 T A 1.2658
88 I A 1.8969
89 A A 0.2746
90 E A -1.2230
91 P A -0.4344
92 A A 0.3376
93 M A 1.4003
94 I A 1.7642
95 A A 0.6616
96 E A -0.5826
97 C A -1.3531
98 K A -1.7522
99 T A -1.3085
100 R A -1.4931
101 T A -1.2270
102 E A -1.3427
103 V A 0.3328
104 F A -0.3969
105 E A -1.4695
106 I A 0.0000
107 S A -1.7344
108 R A -2.8142
109 R A -2.8926
110 L A -0.9014
111 I A -0.9630
112 D A -1.9841
113 R A -2.8589
114 T A -1.7986
115 N A -1.6871
116 A A -1.3921
117 N A -0.9047
118 F A 0.0000
119 L A 0.0044
120 V A -0.5111
121 W A -0.2477
122 P A -0.5519
123 P A -0.5988
124 C A -0.1165
125 V A -0.4034
126 E A -1.6433
127 V A 0.0000
128 Q A -1.2490
129 R A -1.1463
130 C A -1.2762
131 S A -1.2872
132 G A -0.3759
133 C A -0.0920
134 C A -1.4582
135 N A -2.0350
136 N A -2.8712
137 R A -2.9770
138 N A -2.3438
139 V A -1.9678
140 Q A -2.1045
141 C A 0.0000
142 R A -2.5736
143 P A -1.4509
144 T A -1.0553
145 Q A -0.8504
146 V A 0.0400
147 Q A -0.4200
148 L A 0.1144
149 R A -0.7095
150 P A -0.7030
151 V A -0.5657
152 Q A -1.7227
153 V A 0.0000
154 R A -1.5951
155 K A -1.2671
156 I A 0.0000
157 E A 0.0000
158 I A 0.0000
159 V A -2.0818
160 R A -3.1606
161 K A -3.3921
162 K A -3.0069
163 P A -1.3463
164 I A -0.1914
165 F A -0.5480
166 K A -1.7383
167 K A -2.6667
168 A A -1.4503
169 T A -0.9210
170 V A 0.0000
171 T A -0.3922
172 L A 0.0000
173 E A -0.6234
174 D A 0.0000
175 H A 0.0000
176 L A 0.7085
177 A A -0.4499
178 C A -1.6904
179 K A -2.8557
180 C A -2.1288
181 E A -1.8530
182 T A -0.8878
183 V A 0.5956
184 A A 0.3202
185 A A -0.1684
186 A A -0.3302
187 R A -1.4178
188 P A -0.5346
189 V A 0.5185
190 T A -0.5395
191 R A -1.6100
192 S A -1.1745
193 P A -1.1706
194 G A -1.1266
195 G A -1.1146
196 S A -1.5080
197 Q A -2.6157
198 E A -3.4550
199 Q A -3.4165
200 R A -3.1387
201 A A -1.9693
202 K A -2.4000
203 T A -1.3314
204 P A -1.5530
205 Q A -1.8787
206 T A -1.1601
207 R A -1.1451
208 V A 0.9871
209 T A 0.6726
210 I A 1.5054
211 R A -0.4640
212 T A 0.1507
213 V A 0.8365
214 R A -1.1272
215 V A -0.0504
216 R A -2.2664
217 R A -2.9296
218 P A -1.9898
219 P A -2.2006
220 K A -2.9272
221 G A -2.7033
222 K A -3.5469
223 H A -3.2705
224 R A -3.3360
225 K A -2.7014
226 F A -0.6084
227 K A -2.0562
228 H A -2.0672
229 T A -1.9721
230 H A -2.8596
231 D A -3.0580
232 K A -2.7237
233 T A -1.6798
234 A A -0.9744
235 L A -0.1562
236 K A -1.7942
237 E A -1.9245
238 T A -0.4457
239 L A 0.6380
240 G A -0.3829
241 A A -0.0321
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0538 6.8296 View CSV PDB
4.5 -1.14 6.8296 View CSV PDB
5.0 -1.2461 6.8296 View CSV PDB
5.5 -1.3497 6.8296 View CSV PDB
6.0 -1.427 6.8296 View CSV PDB
6.5 -1.463 6.8296 View CSV PDB
7.0 -1.459 6.8296 View CSV PDB
7.5 -1.4296 6.8296 View CSV PDB
8.0 -1.3866 6.8296 View CSV PDB
8.5 -1.3337 6.8294 View CSV PDB
9.0 -1.2713 6.829 View CSV PDB