Project name: 9b1d2585e35660f

Status: done

Started: 2026-05-13 15:40:36
Chain sequence(s) A: MKKITAAAGLLLLAAQPAMAMDPEGESSDGEMSEFEKEMEKLLEILREKLAKDKSLSDYEKFLIEFRVYEDLEYLKLTRDYMDRRVFEEEYKKVLEVIADPEGESSDGEMSEFEKEMEKLLEILREKLAKDKSLSDYEKFLIEFRVYEDLEYLKLTRDYMDRRVFEEEYKKVLEVIADPEGESSDGEMSEFEKEMEKLLEILREKLAKDKSLSDYEKFLIEFRVYEDLEYLKLTRDYMDRRVFEEEYKKVLEVIADPEGESSDGEHHHHHHHK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:09:10)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9b1d2585e35660f/tmp/folded.pdb                (00:09:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:11:59)
Show buried residues

Minimal score value
-4.4747
Maximal score value
3.6427
Average score
-1.6657
Total score value
-454.7279

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.0644
2 K A -1.4399
3 K A -1.2876
4 I A 0.8214
5 T A 0.2223
6 A A 0.3902
7 A A 0.4564
8 A A 0.5504
9 G A 1.0539
10 L A 2.9603
11 L A 3.4450
12 L A 3.6427
13 L A 2.9155
14 A A 1.1913
15 A A 0.2898
16 Q A -0.7877
17 P A -0.3149
18 A A 0.3654
19 M A 0.9457
20 A A 0.4603
21 M A -0.1612
22 D A -2.2203
23 P A -2.0872
24 E A -3.1470
25 G A -2.6650
26 E A -3.2408
27 S A -2.2483
28 S A -2.3016
29 D A -2.7850
30 G A -2.4920
31 E A -2.8848
32 M A -2.2262
33 S A -2.1707
34 E A -3.0238
35 F A 0.0000
36 E A -3.0664
37 K A -4.0141
38 E A -3.5770
39 M A 0.0000
40 E A -3.1050
41 K A -3.4583
42 L A 0.0000
43 L A 0.0000
44 E A -2.8187
45 I A -1.5616
46 L A 0.0000
47 R A -2.4129
48 E A -3.0628
49 K A -3.0508
50 L A 0.0000
51 A A -2.4806
52 K A -3.1387
53 D A -3.0873
54 K A -2.7552
55 S A -1.8656
56 L A -1.5611
57 S A -1.1694
58 D A -1.5734
59 Y A 0.4731
60 E A -0.7532
61 K A -1.0753
62 F A 0.6048
63 L A 0.2217
64 I A -0.3720
65 E A -0.5358
66 F A -0.3860
67 R A -2.0386
68 V A 0.0000
69 Y A -1.3685
70 E A -2.5690
71 D A -2.3689
72 L A 0.0000
73 E A -1.2915
74 Y A -0.1245
75 L A 0.0000
76 K A -0.6863
77 L A 0.9072
78 T A 0.0948
79 R A -1.3715
80 D A -1.6544
81 Y A 0.0060
82 M A -1.0734
83 D A -2.6085
84 R A -3.9512
85 R A -3.8294
86 V A -2.4378
87 F A 0.0000
88 E A -4.4747
89 E A -4.1927
90 E A -3.3230
91 Y A -2.8930
92 K A -3.6445
93 K A -3.6968
94 V A 0.0000
95 L A -1.6917
96 E A -2.7956
97 V A -1.9959
98 I A 0.0000
99 A A -1.5353
100 D A -2.8586
101 P A -2.2946
102 E A -2.7221
103 G A -2.6142
104 E A -3.0532
105 S A -2.1496
106 S A -2.5909
107 D A -2.8676
108 G A -2.4722
109 E A -2.9640
110 M A -2.5683
111 S A -2.2645
112 E A -3.1435
113 F A 0.0000
114 E A -3.4994
115 K A -4.4640
116 E A -4.1314
117 M A 0.0000
118 E A -3.9070
119 K A -3.9716
120 L A 0.0000
121 L A 0.0000
122 E A -3.1946
123 I A -1.7128
124 L A 0.0000
125 R A -2.7714
126 E A -3.2035
127 K A -2.9430
128 L A 0.0000
129 A A -2.4948
130 K A -3.1009
131 D A -2.9661
132 K A -2.5951
133 S A -1.8059
134 L A -1.4721
135 S A -1.0542
136 D A -1.4259
137 Y A 0.4580
138 E A -0.4633
139 K A -0.7839
140 F A 1.0568
141 L A 1.1908
142 I A 0.4611
143 E A 0.2739
144 F A 0.9833
145 R A -0.7735
146 V A 0.0000
147 Y A -0.5601
148 E A -1.7563
149 D A -1.3586
150 L A 0.0000
151 E A -1.4128
152 Y A -0.0228
153 L A 0.0000
154 K A -0.6625
155 L A 0.9075
156 T A 0.1478
157 R A -1.1103
158 D A -1.4971
159 Y A 0.1069
160 M A -0.8819
161 D A -2.5540
162 R A -3.7351
163 R A -3.6724
164 V A -2.2038
165 F A -2.9121
166 E A -4.3279
167 E A -4.0796
168 E A -3.0700
169 Y A -2.6706
170 K A -3.6421
171 K A -3.5992
172 V A 0.0000
173 L A -1.7542
174 E A -2.8403
175 V A -2.0327
176 I A 0.0000
177 A A -1.5617
178 D A -2.9422
179 P A -2.3490
180 E A -2.7667
181 G A -2.6769
182 E A -3.1115
183 S A -2.5818
184 S A -2.6362
185 D A -2.9004
186 G A -2.4945
187 E A -3.0174
188 M A -2.3462
189 S A -2.2202
190 E A -3.0110
191 F A 0.0000
192 E A -3.2049
193 K A -3.9192
194 E A -3.4221
195 M A 0.0000
196 E A -3.0459
197 K A -3.4822
198 L A 0.0000
199 L A 0.0000
200 E A -3.0989
201 I A -1.6415
202 L A 0.0000
203 R A -2.4898
204 E A -3.1402
205 K A -2.9467
206 L A 0.0000
207 A A -2.4768
208 K A -3.1499
209 D A -3.1387
210 K A -2.7532
211 S A -1.9240
212 L A -1.5729
213 S A -1.0292
214 D A -1.3060
215 Y A 0.5853
216 E A -0.4420
217 K A -0.7487
218 F A 1.3104
219 L A 1.0718
220 I A -0.1551
221 E A 0.0217
222 F A 0.4670
223 R A -1.5126
224 V A 0.0000
225 Y A -0.7906
226 E A -2.3146
227 D A -1.8920
228 L A 0.0000
229 E A -1.6569
230 Y A -0.2660
231 L A 0.0000
232 K A -1.1048
233 L A 0.6190
234 T A -0.1786
235 R A -1.8365
236 D A -1.8432
237 Y A -0.0956
238 M A -1.1155
239 D A -2.5681
240 R A -3.9414
241 R A -3.7264
242 V A -2.3308
243 F A -3.1574
244 E A -4.4718
245 E A -4.1268
246 E A -3.1622
247 Y A -2.8545
248 K A -3.6802
249 K A -3.6954
250 V A 0.0000
251 L A -1.8034
252 E A -2.9493
253 V A -2.3720
254 I A 0.0000
255 A A -1.6821
256 D A -3.0973
257 P A -2.5964
258 E A -3.1526
259 G A -2.8979
260 E A -3.2330
261 S A -2.3069
262 S A -2.8523
263 D A -3.1728
264 G A -3.1006
265 E A -3.5793
266 H A -3.3258
267 H A -3.1593
268 H A -3.0945
269 H A -2.9279
270 H A -3.0388
271 H A -2.9801
272 H A -2.8233
273 K A -2.6647
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.4884 4.7488 View CSV PDB
4.5 -1.6911 4.7488 View CSV PDB
5.0 -1.9558 4.7488 View CSV PDB
5.5 -2.2372 4.7488 View CSV PDB
6.0 -2.4808 4.7488 View CSV PDB
6.5 -2.6442 4.7488 View CSV PDB
7.0 -2.7149 4.7488 View CSV PDB
7.5 -2.7139 4.7488 View CSV PDB
8.0 -2.6704 4.7488 View CSV PDB
8.5 -2.5991 4.7486 View CSV PDB
9.0 -2.5039 4.7483 View CSV PDB