Project name: RFA148_protenix

Status: done

Started: 2026-06-15 02:50:12
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSSVETSAIGWYLQKSGQSPQLLIYGTSTRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQGTGVPGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9d2ada38b019dd5/tmp/folded.pdb                (00:01:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:02)
Show buried residues

Minimal score value
-3.2583
Maximal score value
1.4544
Average score
-0.748
Total score value
-176.5198

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7900
2 V A -0.6151
3 Q A -0.8217
4 L A 0.0000
5 V A 0.6319
6 E A 0.0000
7 S A -0.5520
8 G A -1.0122
9 G A -0.5209
10 G A 0.1207
11 L A 0.9342
12 E A -0.5447
13 Q A -1.5580
14 P A -1.6908
15 G A -1.5691
16 G A -1.1602
17 S A -1.4211
18 L A -1.1998
19 R A -2.3512
20 L A 0.0000
21 S A -0.5001
22 C A 0.0000
23 A A -0.2564
24 G A 0.0000
25 S A -0.6777
26 G A -0.9547
27 F A -0.3737
28 T A -0.2693
29 F A 0.0000
30 S A -1.3112
31 S A -0.7977
32 Q A -0.9045
33 G A -0.8885
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.9362
40 A A -1.2876
41 P A -1.0227
42 G A -1.4696
43 K A -2.3884
44 G A -1.5280
45 L A 0.0000
46 E A -1.2773
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0229
51 I A 0.0000
52 S A -0.9215
53 A A -1.3277
54 D A -2.2179
55 G A -1.5005
56 S A -1.0064
57 G A -0.7196
58 T A -0.0877
59 Y A 0.2121
60 Y A -0.5185
61 A A -1.1370
62 D A -2.3841
63 S A -1.6964
64 V A 0.0000
65 K A -2.5016
66 G A -1.8163
67 R A -1.8536
68 F A 0.0000
69 T A -1.0265
70 I A 0.0000
71 S A -0.5400
72 R A -1.3207
73 D A -1.7179
74 N A -2.1867
75 S A -1.7387
76 K A -2.4843
77 N A -1.8913
78 T A -1.1476
79 L A 0.0000
80 Y A -0.6786
81 L A 0.0000
82 Q A -1.7329
83 M A 0.0000
84 N A -2.1402
85 S A -1.5130
86 L A 0.0000
87 R A -2.3273
88 A A -1.7376
89 E A -2.1857
90 D A 0.0000
91 T A -0.7010
92 A A 0.0000
93 V A -0.0375
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.2715
99 L A -0.5110
100 S A -0.9987
101 R A -2.6316
102 V A 0.0000
103 R A -2.9352
104 V A -1.4468
105 G A -1.1538
106 S A -1.0881
107 T A -1.5669
108 R A -2.9810
109 G A 0.0000
110 V A -1.2568
111 V A 0.0000
112 G A 0.0000
113 D A -0.6829
114 V A -0.1670
115 W A -0.2499
116 G A 0.0000
117 Q A -1.3115
118 G A -0.6411
119 T A -0.2945
120 T A 0.0506
121 V A 0.0000
122 T A -0.1548
123 V A 0.0000
124 S A -0.8299
125 S A -0.7526
126 A A -0.2626
127 S A -0.2876
1 D B -0.7035
2 I B 0.5622
3 V B 1.1851
4 M B 0.0000
5 T B -0.5691
6 Q B 0.0000
7 S B -0.4032
8 P B -0.0289
9 L B 0.4991
10 S B -0.0634
11 L B -0.2354
12 P B -1.1716
13 V B 0.0000
14 T B -1.9978
15 P B -2.3207
16 G B -2.1162
17 E B -2.4835
18 P B -2.2718
19 A B 0.0000
20 S B -0.8511
21 I B 0.0000
22 S B -1.0917
23 C B 0.0000
24 R B -2.2448
25 S B 0.0000
26 S B -0.0598
27 V B 0.1419
28 E B -1.6614
29 T B 0.0000
30 S B -1.1150
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -0.7159
38 K B -1.2072
39 S B -0.8414
40 G B -1.4392
41 Q B -2.0742
42 S B -1.3634
43 P B 0.0000
44 Q B -1.0878
45 L B -0.4985
46 L B 0.0000
47 I B 0.0000
48 Y B 0.1117
49 G B -0.8190
50 T B -0.2521
51 S B -0.4814
52 T B -0.5383
53 R B -1.3296
54 G B -0.7842
55 S B -0.6781
56 G B -0.8572
57 V B -0.9648
58 P B -1.3183
59 D B -2.2406
60 R B -2.2507
61 F B 0.0000
62 S B -1.4125
63 G B -0.8592
64 S B -0.9380
65 G B -1.1814
66 S B -1.3440
67 G B -1.3875
68 T B -1.7646
69 D B -2.3473
70 F B 0.0000
71 T B -1.2362
72 L B 0.0000
73 K B -2.0091
74 I B 0.0000
75 S B -2.4525
76 R B -3.2583
77 V B 0.0000
78 E B -2.8489
79 A B -1.7526
80 E B -2.1883
81 D B 0.0000
82 V B -0.6147
83 G B -0.4569
84 F B 0.2880
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B 0.0000
91 T B -0.7084
92 G B 0.2413
93 V B 1.4544
94 P B 0.0000
95 G B 0.0000
96 T B 0.1386
97 F B 0.0427
98 G B 0.0000
99 Q B -1.0237
100 G B 0.0000
101 T B 0.0000
102 K B -0.5172
103 L B 0.0000
104 E B -1.2840
105 I B -1.6908
106 K B -2.2468
107 R B -2.1858
108 T B -0.4326
109 V B 1.0374
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8166 1.7247 View CSV PDB
4.5 -0.8647 1.6575 View CSV PDB
5.0 -0.922 1.5739 View CSV PDB
5.5 -0.9802 1.4831 View CSV PDB
6.0 -1.0298 1.3897 View CSV PDB
6.5 -1.0627 1.3245 View CSV PDB
7.0 -1.0764 1.3094 View CSV PDB
7.5 -1.0758 1.3031 View CSV PDB
8.0 -1.0659 1.301 View CSV PDB
8.5 -1.0489 1.4408 View CSV PDB
9.0 -1.0255 1.5996 View CSV PDB