Project name: 5420b1ef4248f4e [mutate: LQ116A]

Status: done

Started: 2026-06-01 07:58:10
Chain sequence(s) A: EVQLVESGGALVKPGGSLRLSCAASGFTFTEAWMHWVRQAPGKQLEWVAQIKDRSQTYATYYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQSPLSLPVTPGEPASISCRSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGTQAPFTFGSGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues LQ116A
Energy difference between WT (input) and mutated protein (by FoldX) 0.363321 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:29)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)
Show buried residues

Minimal score value
-3.2963
Maximal score value
1.2127
Average score
-0.7225
Total score value
-179.1831

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1777
2 V A -1.3587
3 Q A -1.3970
4 L A 0.0000
5 V A 0.9119
6 E A 0.0000
7 S A -0.5163
8 G A -1.0340
9 G A -0.6695
10 A A 0.2080
11 L A 0.9987
12 V A -0.2188
13 K A -1.8238
14 P A -1.6920
15 G A -1.4031
16 G A -1.0255
17 S A -1.2498
18 L A -0.7613
19 R A -1.8345
20 L A 0.0000
21 S A -0.3549
22 C A 0.0000
23 A A -0.1859
24 A A 0.0000
25 S A -1.1138
26 G A -1.2956
27 F A -0.6740
28 T A -0.5779
29 F A 0.0000
30 T A -1.3884
31 E A -1.8005
32 A A 0.0000
33 W A -0.1881
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -1.0813
40 A A -1.4829
41 P A -1.1043
42 G A -1.5388
43 K A -2.4308
44 Q A -1.7334
45 L A 0.0000
46 E A -1.0935
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 Q A 0.0000
51 I A 0.0000
52 K A -0.7481
53 D A 0.0000
54 R A -2.3720
55 S A -1.6535
56 Q A -1.5034
57 T A -1.0064
58 Y A -0.5312
59 A A -0.2520
60 T A 0.2126
61 Y A 0.1605
62 Y A -0.6000
63 A A -1.2894
64 E A -2.6671
65 S A -1.9839
66 V A 0.0000
67 K A -2.5130
68 G A -1.7342
69 R A -1.5285
70 F A 0.0000
71 T A -0.7657
72 I A 0.0000
73 S A -0.3192
74 R A -0.8550
75 D A -1.4850
76 D A -1.8081
77 S A -1.4922
78 K A -2.3384
79 N A -1.6903
80 T A -0.9817
81 L A 0.0000
82 Y A -0.5449
83 L A 0.0000
84 Q A -1.2275
85 M A 0.0000
86 N A -1.3480
87 S A -1.1691
88 L A 0.0000
89 K A -2.0714
90 T A -1.9364
91 E A -2.5044
92 D A 0.0000
93 T A -0.8005
94 A A 0.0000
95 V A -0.4349
96 Y A 0.0000
97 Y A 0.0000
98 C A 0.0000
99 R A 0.0000
100 G A 0.0000
101 V A 0.0000
102 Y A 0.0897
103 Y A 0.1007
104 A A -0.4796
105 N A -1.1084
106 A A -0.3810
107 P A -0.1144
108 F A 0.3906
109 D A 0.0000
110 Y A 0.1334
111 W A 0.0000
112 G A 0.0000
113 Q A -1.2932
114 G A 0.0000
115 T A -0.7007
116 Q A -0.9799 mutated: LQ116A
117 V A 0.0000
118 T A -0.2629
119 V A 0.0000
120 S A -1.1813
121 S A -1.2504
122 G A -1.1002
123 G A -1.1339
124 G A -1.1691
125 G A -1.1856
126 S A -0.9873
127 G A -1.4089
128 G A -1.4951
129 G A -1.5099
130 G A -1.3978
131 S A -1.2154
132 G A -1.1683
133 G A -1.6836
134 G A -1.4912
135 G A -1.6233
136 S A -1.0542
137 D A -1.4009
138 I A 0.0000
139 V A 0.8358
140 M A 0.0000
141 T A -0.3539
142 Q A 0.0000
143 S A -0.1292
144 P A 0.3713
145 L A 1.2127
146 S A 0.1233
147 L A -0.2238
148 P A -0.9754
149 V A 0.0000
150 T A -1.4661
151 P A -1.7047
152 G A -1.9533
153 E A -2.3758
154 P A -2.1513
155 A A 0.0000
156 S A -0.7165
157 I A 0.0000
158 S A -0.8511
159 C A 0.0000
160 R A -2.3233
161 S A 0.0000
162 S A -0.9393
163 Q A -1.4229
164 S A -0.7794
165 L A 0.0000
166 V A 0.6461
167 H A -0.4969
168 N A -1.2513
169 T A -0.8110
170 G A -0.6696
171 N A -0.4723
172 T A -0.0296
173 Y A 0.0585
174 L A 0.0000
175 S A 0.0000
176 W A 0.0000
177 Y A 0.0000
178 L A 0.0000
179 Q A 0.0000
180 K A -1.6841
181 P A -1.1102
182 G A -1.5197
183 Q A -2.1633
184 S A -1.4457
185 P A 0.0000
186 Q A -0.9512
187 S A 0.0000
188 L A 0.0000
189 I A 0.0000
190 Y A -0.4640
191 K A -0.7589
192 V A -0.6109
193 S A -0.9571
194 N A -1.4390
195 R A -1.9255
196 A A -0.8817
197 S A -0.7182
198 G A -0.8917
199 V A -0.9828
200 P A -1.2799
201 D A -2.3967
202 R A -2.0782
203 F A 0.0000
204 S A -1.3013
205 G A 0.0000
206 S A -0.7700
207 G A -1.0284
208 S A -0.6717
209 G A -0.7118
210 T A -1.4932
211 D A -2.1442
212 F A 0.0000
213 T A -0.9812
214 L A 0.0000
215 K A -1.5147
216 I A 0.0000
217 S A -2.2841
218 R A -3.2963
219 V A 0.0000
220 E A -2.5962
221 A A -1.4398
222 E A -2.2306
223 D A 0.0000
224 V A -0.8647
225 G A 0.0000
226 V A -0.1060
227 Y A 0.0000
228 Y A 0.0000
229 C A 0.0000
230 G A 0.0000
231 Q A 0.0000
232 G A -0.4149
233 T A 0.0000
234 Q A -1.1328
235 A A -0.6029
236 P A -0.8645
237 F A 0.0000
238 T A -0.1367
239 F A 0.0000
240 G A 0.0000
241 S A -0.3562
242 G A 0.0000
243 T A 0.0000
244 K A -0.5010
245 V A 0.0000
246 E A -1.2316
247 I A -0.7756
248 K A -1.6930
Download PDB file
View in 3Dmol