Project name: 9e0fa2d10fad9d

Status: done

Started: 2026-07-27 06:32:46
Chain sequence(s) A: PVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATG
B: MSLEEVLEKMDTLSLEEMLALAKEYLREHADLPPEELLALFDALVAKLLEHAEREGYSREEVDAALSELVRAAREVLAAN
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:25)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/9e0fa2d10fad9d/tmp/folded.pdb                 (00:05:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:28)
Show buried residues

Minimal score value
-4.1947
Maximal score value
1.5913
Average score
-0.8737
Total score value
-157.2619

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 P A -0.4418
2 V A 0.4971
3 L A 0.0000
4 T A -0.4060
5 L A -1.0581
6 R A -2.2532
7 A A -1.3023
8 P A -0.9114
9 G A -1.2553
10 T A -1.0408
11 H A -1.2070
12 A A 0.0000
13 A A 0.2694
14 V A 0.5474
15 G A 0.0516
16 D A 0.1575
17 L A 0.5477
18 L A 0.0000
19 E A -1.6467
20 L A 0.0000
21 H A -0.9452
22 C A 0.0000
23 E A -0.5702
24 A A -0.5012
25 L A 0.5160
26 R A -1.5376
27 G A -1.3855
28 S A -0.8904
29 P A -0.5388
30 L A 0.0000
31 I A 0.0000
32 L A 0.0000
33 Y A 0.0000
34 R A 0.0000
35 F A 0.0000
36 F A 0.0000
37 H A -0.7044
38 E A -1.8029
39 D A -1.5899
40 V A 0.5814
41 T A 0.0486
42 L A 0.3392
43 G A -0.0161
44 N A 0.0000
45 R A -0.9931
46 S A -0.8093
47 S A -0.9278
48 P A -0.8249
49 S A -1.0579
50 G A -0.9546
51 G A 0.0000
52 A A 0.0000
53 S A -0.9301
54 L A -0.8644
55 N A -1.3020
56 L A -0.2737
57 S A 0.0022
58 L A 0.0000
59 T A -0.4381
60 A A -0.5906
61 E A -1.8045
62 H A -0.9350
63 S A -0.3899
64 G A -0.5688
65 N A -1.1847
66 Y A 0.0000
67 S A 0.0000
68 C A 0.0000
69 E A 0.0000
70 A A 0.0000
71 D A 0.0000
72 N A -0.5625
73 G A 0.0000
74 L A 0.9264
75 G A -0.0005
76 A A -0.7659
77 Q A -1.8522
78 R A -2.0209
79 S A 0.0000
80 E A -1.9784
81 T A -1.0876
82 V A 0.0839
83 T A -0.0243
84 L A 0.5975
85 Y A 1.1727
86 I A 0.5792
87 T A 0.4548
88 G A 0.5594
89 L A 1.2463
90 T A -0.1151
91 A A -0.7005
92 N A -2.0245
93 R A -2.7136
94 S A -1.4250
95 G A -0.8482
96 P A 0.1970
97 F A 1.5913
98 A A 0.6967
99 T A 0.2160
100 G A -0.2025
1 M B 0.0270
2 S B -0.7482
3 L B -1.1226
4 E B -2.8918
5 E B -3.1295
6 V B 0.0000
7 L B -2.3767
8 E B -3.8345
9 K B -2.9392
10 M B 0.0000
11 D B -3.1693
12 T B -1.6275
13 L B -1.4625
14 S B -1.5320
15 L B 0.0000
16 E B -2.6370
17 E B -2.3396
18 M B 0.0000
19 L B -1.3805
20 A B -1.5502
21 L B -1.4389
22 A B 0.0000
23 K B -2.3378
24 E B -3.0891
25 Y B 0.0000
26 L B 0.0000
27 R B -3.9855
28 E B -3.5064
29 H B -2.6064
30 A B -2.4866
31 D B -2.7027
32 L B -1.7589
33 P B -1.7628
34 P B -1.9466
35 E B -2.6415
36 E B -2.6033
37 L B 0.0000
38 L B -1.1957
39 A B -1.1289
40 L B 0.0000
41 F B 0.0000
42 D B -0.6496
43 A B -0.3345
44 L B 0.0000
45 V B 0.0000
46 A B -0.5981
47 K B -1.3747
48 L B 0.0000
49 L B 0.0000
50 E B -2.8785
51 H B 0.0000
52 A B 0.0000
53 E B -3.9307
54 R B -4.1947
55 E B -3.7642
56 G B -2.5526
57 Y B -2.1318
58 S B -2.1932
59 R B -2.8283
60 E B -3.1352
61 E B -2.9013
62 V B 0.0000
63 D B -1.6501
64 A B -1.2613
65 A B 0.0000
66 L B 0.0000
67 S B 0.0000
68 E B -0.8912
69 L B 0.0000
70 V B 0.0000
71 R B -1.5161
72 A B 0.0000
73 A B 0.0000
74 R B -1.5131
75 E B -2.4654
76 V B 0.0000
77 L B -1.3105
78 A B -0.9114
79 A B -1.3376
80 N B -1.7360
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4075 5.2465 View CSV PDB
4.5 -0.5174 5.2465 View CSV PDB
5.0 -0.6618 5.2465 View CSV PDB
5.5 -0.8184 5.2465 View CSV PDB
6.0 -0.9632 5.2465 View CSV PDB
6.5 -1.076 5.2465 View CSV PDB
7.0 -1.1488 5.2465 View CSV PDB
7.5 -1.1905 5.2465 View CSV PDB
8.0 -1.2151 5.2465 View CSV PDB
8.5 -1.23 5.2465 View CSV PDB
9.0 -1.2368 5.2465 View CSV PDB