Project name: mi2699_2VY0_25C_conf3

Status: done

Started: 2026-05-22 14:58:55
Chain sequence(s) A: VPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:21)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a1d1c16b5c91157/tmp/folded.pdb                (00:06:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:51)
Show buried residues

Minimal score value
-3.4177
Maximal score value
1.5709
Average score
-0.6547
Total score value
-172.1869

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
35 V A 1.2538
36 P A 0.1986
37 E A -0.7476
38 V A 0.4506
39 I A -0.3561
40 E A -1.8937
41 I A -1.1885
42 D A -1.3892
43 G A -1.5877
44 K A -1.3366
45 Q A -0.9715
46 W A 0.0000
47 R A -0.5753
48 L A 0.0000
49 I A 0.8025
50 W A 0.2320
51 H A 0.0158
52 D A -0.9444
53 E A -1.1240
54 F A 0.0000
55 E A -2.6528
56 G A -2.1656
57 S A -1.7023
58 E A -2.3586
59 V A -1.7919
60 N A -2.1996
61 K A -2.9148
62 E A -2.7000
63 Y A -1.5227
64 W A 0.0000
65 T A -1.1406
66 F A -0.7650
67 E A 0.0000
68 K A -1.5499
69 G A -0.7637
70 N A 0.0000
71 G A 0.0000
72 I A 0.5430
73 A A 0.6591
74 Y A 1.4201
75 G A 0.8679
76 I A 1.0604
77 P A 0.1621
78 G A -0.4917
79 W A -0.1383
80 G A -0.8387
81 N A -1.6515
82 G A -1.2607
83 E A -1.0772
84 L A 0.2807
85 E A 0.0000
86 Y A 0.0478
87 Y A 0.0000
88 T A -1.4324
89 E A -2.1220
90 N A -1.8549
91 N A 0.0000
92 T A 0.0000
93 Y A -0.3047
94 I A 0.0000
95 V A -0.5824
96 N A -1.4581
97 G A -1.5443
98 T A 0.0000
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A 0.0000
103 A A 0.0000
104 R A -0.8289
105 K A -0.7716
106 E A -0.8100
107 I A 1.5460
108 I A 0.8829
109 T A -0.3469
110 D A -2.0047
111 P A -1.8005
112 N A -2.2114
113 E A -1.9943
114 G A -1.2862
115 T A -0.0871
116 F A 0.6752
117 L A 1.1345
118 Y A 0.0000
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.7865
123 L A 0.0000
124 K A 0.0000
125 T A 0.0000
126 E A -0.8846
127 G A -1.2897
128 K A -1.7557
129 V A -1.1062
130 E A -1.9546
131 F A -0.9375
132 S A -1.2326
133 P A -0.7882
134 P A -0.0886
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.3861
139 A A 0.0000
140 R A -0.8791
141 I A 0.0000
142 K A -1.4107
143 L A 0.0000
144 P A 0.0000
145 K A -2.7213
146 G A -2.0545
147 K A -2.7850
148 G A 0.0000
149 L A 0.0000
150 W A 0.0532
151 P A 0.0000
152 A A -0.1765
153 F A 0.0000
154 W A 0.0000
155 M A 0.0000
156 L A 0.0000
157 G A 0.0000
158 S A -1.5073
159 N A -1.6417
160 I A -1.1640
161 R A -2.4429
162 E A -2.3904
163 V A -0.5914
164 G A -0.4930
165 W A 0.3534
166 P A 0.0635
167 N A -1.0694
168 C A 0.0000
169 G A 0.0000
170 E A -0.2875
171 I A 0.0000
172 D A -0.3862
173 I A 0.0000
174 M A 0.0000
175 E A -0.3446
176 F A 0.0000
177 L A -0.5772
178 G A 0.0000
179 H A -2.3169
180 E A -1.8802
181 P A -1.8788
182 R A -1.4828
183 T A -0.7707
184 I A 0.0000
185 H A -0.7616
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A -0.5784
190 G A 0.0000
191 P A -0.9488
192 G A -1.0532
193 Y A 0.0000
194 S A -0.9556
195 G A -1.1072
196 S A -1.1639
197 K A -1.9104
198 G A 0.0000
199 I A -0.6011
200 T A -1.2775
201 R A -1.9530
202 A A -0.8270
203 Y A -0.1610
204 T A -0.5373
205 L A 0.0000
206 P A -1.0966
207 E A -2.0242
208 G A -1.0995
209 V A -0.2764
210 P A -1.1110
211 D A -1.6832
212 F A 0.0000
213 T A 0.0000
214 E A -2.8319
215 D A -1.9779
216 F A -1.0350
217 H A 0.0000
218 V A -0.7657
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A 0.0000
225 P A -1.4447
226 D A -1.9769
227 K A -1.9700
228 I A 0.0000
229 K A -1.0465
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.8468
234 G A -1.0911
235 T A -0.3767
236 F A -0.0317
237 Y A -0.2221
238 H A 0.0000
239 E A -2.0249
240 V A 0.0000
241 T A -2.2970
242 K A -3.0165
243 E A -3.4177
244 Q A -2.6777
245 V A 0.0000
246 E A -3.1442
247 A A -1.6330
248 M A -0.8314
249 G A -1.5412
250 Y A -1.3815
251 E A -2.2605
252 W A -2.2516
253 V A -1.3887
254 F A 0.0000
255 D A -2.2340
256 K A -2.2592
257 P A -1.5646
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A -0.2969
264 L A 0.0000
265 A A -0.0071
266 V A 0.0000
267 G A -0.5329
268 G A 0.1373
269 Y A 1.3759
270 W A 1.5709
271 P A 0.0000
272 G A -0.5653
273 N A -1.5572
274 P A -1.6064
275 D A -1.4828
276 A A -0.4397
277 T A -0.4986
278 T A 0.0000
279 P A -0.9306
280 F A -0.8073
281 P A -0.9739
282 A A 0.0000
283 K A -1.4938
284 M A 0.0000
285 V A -0.3740
286 V A 0.0000
287 D A -0.9415
288 Y A 0.0000
289 V A 0.0000
290 R A -0.1994
291 V A 0.0000
292 Y A 0.0000
293 S A 0.7520
294 F A 1.1435
295 V A 1.2885
296 S A -0.2509
297 G A -0.8292
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.195 4.1795 View CSV PDB
4.5 -0.2642 4.1795 View CSV PDB
5.0 -0.3558 4.1795 View CSV PDB
5.5 -0.4528 4.1795 View CSV PDB
6.0 -0.5369 4.1795 View CSV PDB
6.5 -0.5933 4.1795 View CSV PDB
7.0 -0.6167 4.1795 View CSV PDB
7.5 -0.6147 4.1794 View CSV PDB
8.0 -0.5989 4.1793 View CSV PDB
8.5 -0.5761 4.179 View CSV PDB
9.0 -0.5481 4.1781 View CSV PDB