Project name: a2493aa0bc8af63

Status: done

Started: 2025-02-25 21:08:36
Chain sequence(s) A: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:00)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a2493aa0bc8af63/tmp/folded.pdb                (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:16)
Show buried residues

Minimal score value
-4.2124
Maximal score value
1.1643
Average score
-0.8454
Total score value
-231.6458

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.8062
2 A A -0.0339
3 S A -0.8924
4 D A -2.1267
5 S A -1.8192
6 G A -2.0255
7 N A -2.3632
8 Q A -1.9879
9 G A -1.1990
10 T A -0.4790
11 L A -0.0783
12 C A 0.0000
13 T A 0.0000
14 L A 0.0000
15 E A 0.0000
16 F A 0.0000
17 A A 0.0000
18 V A 0.0000
19 Q A -0.9468
20 M A 0.0000
21 T A -0.4738
22 C A -0.6259
23 Q A -1.2777
24 S A -1.0237
25 C A -0.9590
26 V A 0.0000
27 D A -1.8226
28 A A -1.6470
29 V A 0.0000
30 R A -2.3889
31 K A -2.6307
32 S A -1.5445
33 L A 0.0000
34 Q A -2.4279
35 G A -1.4935
36 V A -0.4419
37 A A -0.2108
38 G A -0.6086
39 V A -0.9814
40 Q A -2.0246
41 D A -2.6551
42 V A 0.0000
43 E A -1.3882
44 V A -1.0516
45 H A -1.5143
46 L A -1.6272
47 E A -2.6634
48 D A -2.8442
49 Q A -1.7306
50 M A -1.1808
51 V A 0.0000
52 L A 0.0000
53 V A 0.0000
54 H A -1.0513
55 T A 0.0000
56 T A -0.4277
57 L A -0.2529
58 P A -0.5785
59 S A 0.0000
60 Q A -1.2543
61 E A -1.6562
62 V A 0.0000
63 Q A -1.0590
64 A A -1.0233
65 L A -0.7035
66 L A 0.0000
67 E A -1.3842
68 G A -0.9435
69 T A -0.9742
70 G A -1.0980
71 R A -1.1822
72 Q A -1.4224
73 A A 0.0000
74 V A -0.0789
75 L A 0.0560
76 K A -0.3544
77 G A 0.0000
78 M A 0.0000
79 G A 0.0000
80 S A 0.0000
81 G A -0.4198
82 Q A -0.8731
83 L A 0.4892
84 Q A -0.4870
85 N A -0.6344
86 L A 0.1055
87 G A -0.2789
88 A A -0.4555
89 A A 0.0000
90 V A 0.1342
91 A A 0.0000
92 I A 1.1643
93 L A 0.0000
94 G A -0.3915
95 G A -0.8657
96 P A -0.8276
97 G A -0.7916
98 T A -0.7519
99 V A 0.0000
100 Q A -1.0278
101 G A -0.0917
102 V A 0.5449
103 V A 0.0000
104 R A -0.1956
105 F A 0.0000
106 L A 0.0000
107 Q A 0.0000
108 L A 0.0000
109 T A -1.3643
110 P A -1.4954
111 E A -2.8864
112 R A -2.4692
113 C A 0.0000
114 L A 0.0000
115 I A 0.0000
116 E A 0.0000
117 G A 0.0000
118 T A -0.0382
119 I A 0.0000
120 D A -1.7829
121 G A -1.7808
122 L A 0.0000
123 E A -3.0214
124 P A -2.1480
125 G A -1.7913
126 L A -1.5304
127 H A 0.0000
128 G A 0.0000
129 L A 0.0000
130 H A 0.0000
131 V A 0.0000
132 H A 0.0000
133 Q A -0.2355
134 Y A 0.7585
135 G A 0.2610
136 D A -0.7343
137 L A -0.4584
138 T A -1.0833
139 N A -2.0999
140 N A -2.0204
141 C A 0.0000
142 N A -2.3698
143 S A -1.3062
144 C A 0.0000
145 G A -0.5955
146 N A -0.6031
147 H A 0.0000
148 F A 0.0000
149 N A -1.3926
150 P A -1.5107
151 D A -2.4915
152 G A -1.7515
153 A A -1.6005
154 S A -1.1647
155 H A 0.0000
156 G A 0.0000
157 G A 0.0000
158 P A -1.3805
159 Q A -1.6542
160 D A -1.6091
161 S A -1.8278
162 D A -2.5117
163 R A 0.0000
164 H A 0.0000
165 R A -1.5418
166 G A 0.0000
167 D A 0.0000
168 L A 0.0000
169 G A 0.0000
170 N A -1.0397
171 V A 0.0000
172 R A -2.2144
173 A A 0.0000
174 D A -2.2759
175 A A -1.9339
176 D A -2.7726
177 G A 0.0000
178 R A -2.4577
179 A A 0.0000
180 I A 0.2973
181 F A 0.2525
182 R A -0.0722
183 M A -0.2862
184 E A -1.2366
185 D A 0.0000
186 E A -3.0640
187 Q A -1.9525
188 L A 0.0000
189 K A -0.9777
190 V A 0.0000
191 W A 0.5874
192 D A -0.2180
193 V A 0.0000
194 I A 0.0603
195 G A -0.2805
196 R A -0.0564
197 S A 0.0000
198 L A 0.0000
199 I A 0.0000
200 I A 0.0000
201 D A 0.0000
202 E A -3.3025
203 G A -2.6723
204 E A -2.5770
205 D A 0.0000
206 D A -1.9950
207 L A -1.2535
208 G A 0.0000
209 R A -2.6840
210 G A -2.1453
211 G A -1.8873
212 H A -1.5425
213 P A -0.7124
214 L A -0.3522
215 S A 0.0000
216 K A -1.6950
217 I A 0.2500
218 T A -0.1804
219 G A 0.0000
220 N A -2.1086
221 S A 0.0000
222 G A -2.5218
223 E A -3.0410
224 R A -2.1305
225 L A -1.3947
226 A A 0.0000
227 C A 0.0000
228 G A 0.0000
229 I A 0.8142
230 I A 0.0000
231 A A -0.5314
232 R A -1.5896
233 S A -1.1495
234 A A -0.7716
235 G A 0.0000
236 L A 0.0000
237 F A 1.0930
238 Q A -0.9399
239 N A -1.3455
240 P A -1.5580
241 K A -2.3176
242 Q A -1.5684
243 I A -0.3320
244 C A -0.4276
245 S A -0.1789
246 C A 0.3592
247 D A -1.2883
248 G A -0.9009
249 L A 0.0000
250 T A -1.0179
251 I A -1.1849
252 W A -1.3827
253 E A -2.2283
254 E A -2.3283
255 R A -1.8511
256 G A -1.5921
257 R A -1.6422
258 P A -0.6516
259 I A 1.0601
260 A A -0.3285
261 G A -1.6698
262 K A -3.3647
263 G A -2.9460
264 R A -3.9284
265 K A -4.2124
266 E A -3.9257
267 S A -2.3759
268 A A -2.0688
269 Q A -1.7323
270 P A -0.9780
271 P A -0.7040
272 A A -0.4087
273 H A -0.2831
274 L A 0.9770
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3552 3.8702 View CSV PDB
4.5 -0.418 3.8703 View CSV PDB
5.0 -0.4974 3.8706 View CSV PDB
5.5 -0.5811 3.8715 View CSV PDB
6.0 -0.6561 3.8737 View CSV PDB
6.5 -0.7128 3.8785 View CSV PDB
7.0 -0.7486 3.8857 View CSV PDB
7.5 -0.7685 3.8946 View CSV PDB
8.0 -0.7785 3.904 View CSV PDB
8.5 -0.7802 3.9137 View CSV PDB
9.0 -0.773 3.9234 View CSV PDB