Project name: Caplacizumab

Status: done

Started: 2026-06-23 07:30:46
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSSAAAEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a2ae7649eff37ad/tmp/folded.pdb                (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:29)
Show buried residues

Minimal score value
-3.3884
Maximal score value
1.2436
Average score
-0.7724
Total score value
-200.0518

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.3301
2 V A -1.6017
3 Q A -1.2434
4 L A 0.0000
5 V A 1.2016
6 E A 0.0000
7 S A -0.4201
8 G A -1.0245
9 G A -0.7800
10 G A -0.0571
11 L A 1.2436
12 V A 0.4434
13 Q A -0.5110
14 P A -1.2990
15 G A -1.1718
16 G A -0.6659
17 S A -1.1942
18 L A -1.0246
19 R A -2.2761
20 L A 0.0000
21 S A -0.3601
22 C A 0.0000
23 A A -0.1594
24 A A 0.0000
25 S A -1.2606
26 G A -2.1053
27 R A -2.2775
28 T A -1.3416
29 F A 0.0000
30 S A -0.9766
31 Y A -0.4854
32 N A 0.0000
33 P A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.4499
40 A A -1.5385
41 P A -1.0786
42 G A -1.6409
43 K A -2.5769
44 G A -2.0295
45 R A -1.6826
46 E A -1.0508
47 L A 0.0265
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A 0.0000
53 R A -1.6191
54 T A -0.9040
55 G A -1.0882
56 G A -1.0208
57 S A -0.7826
58 T A -0.1827
59 Y A 0.0269
60 Y A -0.6657
61 P A -1.3075
62 D A -2.5084
63 S A -1.7629
64 V A 0.0000
65 E A -2.6729
66 G A -1.8134
67 R A -1.5927
68 F A 0.0000
69 T A -0.9172
70 I A 0.0000
71 S A -0.5276
72 R A -1.1623
73 D A -1.6661
74 N A -1.9074
75 A A -1.5820
76 K A -2.5307
77 R A -2.5492
78 M A -1.0894
79 V A 0.0000
80 Y A -0.5888
81 L A 0.0000
82 Q A -1.6045
83 M A 0.0000
84 N A -1.4824
85 S A -1.1057
86 L A 0.0000
87 R A -2.1974
88 A A -1.5889
89 E A -2.2562
90 D A 0.0000
91 T A -0.8237
92 A A 0.0000
93 V A -0.3330
94 Y A 0.0000
95 Y A -0.1119
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 G A 0.1720
101 V A 0.4712
102 R A -1.6472
103 A A 0.0000
104 E A -3.1662
105 D A -3.3884
106 G A -2.7219
107 R A -2.8364
108 V A -0.9808
109 R A -0.1799
110 T A 0.3508
111 L A 1.1470
112 P A 0.0669
113 S A -0.0886
114 E A 0.0336
115 Y A 0.0000
116 T A 0.2256
117 F A 0.0628
118 W A 0.2970
119 G A -0.0327
120 Q A -0.7898
121 G A 0.0000
122 T A -0.6105
123 Q A -0.9417
124 V A 0.0000
125 T A -0.1030
126 V A 0.0000
127 S A -0.4470
128 S A -0.6597
129 A A -0.5153
130 A A -0.4631
131 A A -1.4944
132 E A -2.5128
133 V A 0.0000
134 Q A -1.5656
135 L A 0.0000
136 V A 0.5820
137 E A -0.2398
138 S A -0.6633
139 G A -1.0731
140 G A -0.8337
141 G A -0.0620
142 L A 0.9955
143 V A -0.0131
144 Q A -1.3009
145 P A -1.4767
146 G A -1.3324
147 G A -0.9318
148 S A -1.2238
149 L A -0.9104
150 R A -2.1344
151 L A 0.0000
152 S A -0.4710
153 C A 0.0000
154 A A -0.3632
155 A A 0.0000
156 S A -1.3779
157 G A -2.1460
158 R A -2.2365
159 T A -1.5347
160 F A 0.0000
161 S A -1.0190
162 Y A -0.7269
163 N A 0.0000
164 P A 0.0000
165 M A 0.0000
166 G A 0.0000
167 W A 0.0000
168 F A 0.0000
169 R A -1.2553
170 Q A -1.7674
171 A A -1.5565
172 P A -1.0913
173 G A -1.6459
174 K A -2.7225
175 G A -2.2855
176 R A -2.2055
177 E A -1.9056
178 L A -0.4046
179 V A 0.0000
180 A A 0.0000
181 A A 0.0000
182 I A 0.0000
183 S A 0.0000
184 R A -1.7397
185 T A -0.9813
186 G A -1.1166
187 G A -1.0357
188 S A -0.7928
189 T A -0.2360
190 Y A 0.0345
191 Y A -0.6730
192 P A -1.4075
193 D A -2.5386
194 S A -1.8267
195 V A 0.0000
196 E A -2.7021
197 G A -1.8462
198 R A -1.5945
199 F A 0.0000
200 T A -0.8094
201 I A 0.0000
202 S A -0.4780
203 R A -1.1663
204 D A -1.6401
205 N A -1.8977
206 A A -1.5489
207 K A -2.4911
208 R A -2.2633
209 M A -1.1416
210 V A 0.0000
211 Y A -0.5332
212 L A 0.0000
213 Q A -1.2581
214 M A 0.0000
215 N A -1.3948
216 S A -1.2009
217 L A 0.0000
218 R A -2.0563
219 A A -1.5835
220 E A -2.1641
221 D A 0.0000
222 T A -0.8060
223 A A 0.0000
224 V A -0.4460
225 Y A 0.0000
226 Y A 0.0000
227 C A 0.0000
228 A A 0.0000
229 A A 0.0000
230 A A 0.0000
231 G A -0.0279
232 V A 0.3482
233 R A -1.7540
234 A A 0.0000
235 E A -3.1333
236 D A -3.2355
237 G A -2.6966
238 R A -2.7820
239 V A -0.9503
240 R A -0.1468
241 T A 0.2900
242 L A 1.0441
243 P A -0.1106
244 S A -0.1248
245 E A -0.0499
246 Y A 0.0000
247 T A 0.0924
248 F A -0.2381
249 W A 0.0642
250 G A -0.3658
251 Q A -1.0306
252 G A -0.7105
253 T A -0.8293
254 Q A -1.0273
255 V A 0.0000
256 T A -0.2352
257 V A 0.0000
258 S A -0.3769
259 S A -0.4615
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7398 1.8126 View CSV PDB
4.5 -0.7869 1.8126 View CSV PDB
5.0 -0.845 1.8126 View CSV PDB
5.5 -0.9054 1.8126 View CSV PDB
6.0 -0.9584 1.8126 View CSV PDB
6.5 -0.9956 1.8126 View CSV PDB
7.0 -1.0144 1.8126 View CSV PDB
7.5 -1.0192 1.8126 View CSV PDB
8.0 -1.0152 1.8126 View CSV PDB
8.5 -1.0047 1.8126 View CSV PDB
9.0 -0.9892 1.8126 View CSV PDB