Project name: a35d26094ad7f52

Chain sequence(s)	A: MQYYETREKEYYDVAQGQSRQSYGQNHQGYGQSQSRPVYGNSPTLNYRSHGGFLDGLFKGKNGQKGQNGLGSFLGQHKNQDTNQGHGHGKLLGQHQKKTHETNKGVNGLGMFINNGEKKHKKQNEHKKKKNKDGHASGNESGSSSGSDSE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
pH calculations	No
alphaCutter usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -4.5493
• Maximal score value: 2.946
• Average score: -1.5163
• Total score value: -227.4406

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan4D score	mutation
1	M	A	0.9170
2	Q	A	0.0127
3	Y	A	1.1812
4	Y	A	0.6182
5	E	A	-1.7106
6	T	A	-2.1614
7	R	A	-3.6831
8	E	A	-4.0052
9	K	A	-3.3767
10	E	A	-2.7149
11	Y	A	0.1434
12	Y	A	0.8955
13	D	A	-0.4318
14	V	A	1.0887
15	A	A	0.0149
16	Q	A	-1.4524
17	G	A	-1.4319
18	Q	A	-2.2050
19	S	A	-2.1484
20	R	A	-2.8532
21	Q	A	-2.0246
22	S	A	-0.8656
23	Y	A	0.4430
24	G	A	-1.0195
25	Q	A	-2.0017
26	N	A	-2.8216
27	H	A	-2.5496
28	Q	A	-1.9733
29	G	A	-1.0858
30	Y	A	0.1713
31	G	A	-0.8778
32	Q	A	-1.5839
33	S	A	-1.6060
34	Q	A	-2.2672
35	S	A	-1.7226
36	R	A	-1.7816
37	P	A	-0.4084
38	V	A	1.4145
39	Y	A	1.3249
40	G	A	-0.0014
41	N	A	-1.0984
42	S	A	-0.6227
43	P	A	-0.4388
44	T	A	0.1441
45	L	A	0.9226
46	N	A	-0.5632
47	Y	A	0.0610
48	R	A	-1.8106
49	S	A	-1.6779
50	H	A	-1.7027
51	G	A	-0.9791
52	G	A	0.2443
53	F	A	2.0612
54	L	A	2.2389
55	D	A	-0.2259
56	G	A	0.1639
57	L	A	1.9174
58	F	A	1.2657
59	K	A	-1.6282
60	G	A	-1.9878
61	K	A	-2.7985
62	N	A	-3.3168
63	G	A	-3.1467
64	Q	A	-3.2257
65	K	A	-3.2158
66	G	A	-2.6843
67	Q	A	-2.5566
68	N	A	-2.0336
69	G	A	-0.8956
70	L	A	0.7949
71	G	A	0.5944
72	S	A	1.1715
73	F	A	2.3604
74	L	A	1.7223
75	G	A	-0.1974
76	Q	A	-1.7800
77	H	A	-2.8844
78	K	A	-3.4870
79	N	A	-3.4829
80	Q	A	-3.3808
81	D	A	-2.9912
82	T	A	-2.3583
83	N	A	-2.6369
84	Q	A	-2.3727
85	G	A	-2.0883
86	H	A	-2.1777
87	G	A	-2.0438
88	H	A	-2.0340
89	G	A	-1.3687
90	K	A	-1.1384
91	L	A	0.9401
92	L	A	1.1178
93	G	A	-0.4093
94	Q	A	-1.5851
95	H	A	-2.6892
96	Q	A	-3.2342
97	K	A	-3.3309
98	K	A	-3.1463
99	T	A	-2.2513
100	H	A	-2.4457
101	E	A	-2.9269
102	T	A	-2.3210
103	N	A	-2.6247
104	K	A	-2.4074
105	G	A	-1.1059
106	V	A	0.3497
107	N	A	-0.3564
108	G	A	0.0910
109	L	A	1.4276
110	G	A	1.3028
111	M	A	2.5313
112	F	A	2.9460
113	I	A	2.1513
114	N	A	-0.8569
115	N	A	-2.0433
116	G	A	-2.8901
117	E	A	-4.1152
118	K	A	-4.4645
119	K	A	-4.4066
120	H	A	-4.2016
121	K	A	-4.3158
122	K	A	-4.3467
123	Q	A	-3.9699
124	N	A	-3.9607
125	E	A	-4.1786
126	H	A	-3.8678
127	K	A	-4.3188
128	K	A	-4.4752
129	K	A	-4.5086
130	K	A	-4.5493
131	N	A	-4.1930
132	K	A	-4.2026
133	D	A	-3.6599
134	G	A	-2.6169
135	H	A	-2.0077
136	A	A	-1.2472
137	S	A	-1.2671
138	G	A	-1.9486
139	N	A	-2.5540
140	E	A	-2.9190
141	S	A	-1.8079
142	G	A	-1.5435
143	S	A	-0.9794
144	S	A	-0.7242
145	S	A	-0.9304
146	G	A	-1.1378
147	S	A	-1.5224
148	D	A	-2.5031
149	S	A	-2.0325
150	E	A	-2.2884