Project name: 17 FULL

Status: done

Started: 2026-06-05 10:57:51
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRETGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYYINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
B: DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a3a5de112959b8c/tmp/folded.pdb                (00:04:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:29)
Show buried residues

Minimal score value
-3.5673
Maximal score value
2.524
Average score
-0.6433
Total score value
-192.3459

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.4944
2 I A -0.3000
3 V A 0.7301
4 M A 0.0000
5 T A -0.5414
6 Q A 0.0000
7 S A -0.2862
8 P A 0.0475
9 L A 0.5774
10 S A -0.1758
11 L A -0.4299
12 P A -1.2121
13 V A 0.0000
14 T A -1.6612
15 P A -1.7323
16 G A -1.8303
17 E A -2.2496
18 P A -2.1778
19 A A 0.0000
20 S A -0.8845
21 I A 0.0000
22 S A -1.0261
23 C A 0.0000
24 R A -2.2900
25 S A 0.0000
26 S A -0.9458
27 Q A -1.5193
28 S A -0.9987
29 L A 0.0000
30 L A -0.3729
31 N A 0.0000
32 G A -0.7483
33 Y A -0.3641
34 N A -1.2521
35 Q A -1.6336
36 K A -1.3043
37 N A 0.0000
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A 0.0000
45 K A -1.7043
46 P A -1.1908
47 G A -1.5298
48 Q A -2.0901
49 S A -1.2962
50 P A 0.0000
51 Q A -1.1275
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.4713
57 A A 0.0000
58 S A -0.7306
59 T A -0.6272
60 R A -1.4054
61 E A -1.1103
62 T A -0.6058
63 G A -0.9421
64 V A -1.0002
65 P A -1.3146
66 D A -2.2651
67 R A -2.2464
68 F A 0.0000
69 S A -1.5090
70 G A -0.9641
71 S A -1.0034
72 G A -1.2251
73 S A -1.1980
74 G A -1.0666
75 T A -1.7339
76 D A -2.4711
77 F A 0.0000
78 T A -1.2875
79 L A 0.0000
80 K A -2.1526
81 I A 0.0000
82 S A -2.4182
83 R A -3.0916
84 V A 0.0000
85 E A -2.2570
86 A A -1.6155
87 E A -2.3416
88 D A 0.0000
89 V A -1.0667
90 G A 0.0000
91 V A -0.3869
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.0988
99 S A -0.2760
100 Y A -0.2622
101 P A -0.7168
102 F A 0.0000
103 T A 0.0198
104 F A 0.1066
105 G A 0.0000
106 Q A -1.1218
107 G A 0.0000
108 T A 0.0000
109 K A -1.0027
110 L A 0.0000
111 E A -1.8746
112 I A -1.6038
113 K A -2.3902
114 G A -1.7695
115 G A -1.6629
116 G A -1.4493
117 G A -1.4595
118 S A -1.0740
119 G A -1.5836
120 G A -1.5570
121 G A -1.8049
122 G A -1.6479
123 S A -1.2562
124 G A -1.2327
125 G A -1.2332
126 G A -1.3695
127 G A -1.3949
128 S A -1.3165
129 Q A -1.7078
130 V A -1.0771
131 Q A -1.6604
132 L A 0.0000
133 V A -0.6218
134 Q A 0.0000
135 S A -0.6672
136 G A -0.5447
137 A A 0.2660
138 E A 0.0653
139 V A 0.9894
140 K A -0.9776
141 K A -2.1932
142 P A -2.2942
143 G A -1.6145
144 A A -1.2624
145 S A -1.3249
146 V A 0.0000
147 K A -1.7794
148 V A 0.0000
149 S A -0.7401
150 C A 0.0000
151 K A -1.4406
152 A A 0.0000
153 S A -0.9352
154 G A -0.8366
155 Y A -0.3653
156 T A -0.2195
157 F A 0.0000
158 N A -1.1896
159 S A -0.2876
160 Y A 0.0208
161 Y A 0.0000
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.3387
167 Q A -0.5970
168 A A -0.9584
169 P A -0.9496
170 G A -1.2167
171 Q A -1.8687
172 G A -1.3070
173 L A 0.0000
174 E A -0.7343
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.0000
181 P A 0.0000
182 S A -1.2306
183 D A -1.6914
184 S A -0.6779
185 Y A 0.6109
186 T A 0.3407
187 N A -0.1557
188 Y A -1.2152
189 N A -1.9893
190 Q A -3.1271
191 K A -3.0842
192 F A 0.0000
193 K A -3.5673
194 D A -3.3052
195 R A -2.3380
196 V A 0.0000
197 T A -1.0853
198 M A 0.0000
199 T A -0.2948
200 R A -1.2168
201 D A -1.0461
202 T A -0.7620
203 S A -0.5179
204 T A -0.6936
205 S A -0.9004
206 T A 0.0000
207 V A 0.0000
208 Y A -0.7060
209 M A 0.0000
210 E A -1.4025
211 L A 0.0000
212 S A -1.3323
213 S A -1.4088
214 L A 0.0000
215 R A -3.1460
216 S A -2.4227
217 E A -2.5887
218 D A 0.0000
219 T A -0.7871
220 A A 0.0000
221 V A 0.4643
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A 0.1099
229 R A -0.4706
230 G A 0.0000
231 N A 0.0000
232 S A 0.0000
233 F A 0.0000
234 D A -0.2336
235 Y A -0.1891
236 W A -0.4601
237 G A 0.0000
238 Q A -1.3798
239 G A -0.4985
240 T A 0.0000
241 L A 0.8883
242 V A 0.0000
243 T A -0.1345
244 V A 0.0000
245 S A -1.1359
246 S A -1.0414
1 D B -2.1565
2 Q B -1.8499
3 W B -0.4198
4 S B -0.7431
5 T B -0.7305
6 Q B -1.2950
7 D B -2.0649
8 L B -0.5639
9 Y B -0.4380
10 N B -1.3616
11 N B -0.7877
12 P B -0.7599
13 V B 0.0000
14 T B 0.0000
15 A B -0.9024
16 V B 0.0000
17 F B -0.4746
18 N B 0.0000
19 Y B -0.3407
20 Q B -0.5534
21 G B -0.6601
22 L B 0.6213
23 W B 0.5282
24 R B -0.7019
25 S B 0.0000
26 C B 0.0000
27 V B 0.0000
28 R B -0.8927
29 E B 0.0000
30 S B 0.0000
31 S B 0.0000
32 G B -0.3160
33 F B -0.1404
34 T B -0.8480
35 E B -1.7255
36 C B -1.1599
37 R B -1.4108
38 G B -0.4079
39 Y B 1.1712
40 F B 2.1434
41 T B 2.0578
42 L B 2.5240
43 L B 2.2351
44 G B 0.9801
45 L B 0.0000
46 P B 0.3507
47 A B 0.6731
48 M B 0.9391
49 L B 0.0000
50 Q B -0.0810
51 A B 0.2039
52 V B 0.7598
53 R B -1.1999
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4809 4.5123 View CSV PDB
4.5 -0.5246 4.5123 View CSV PDB
5.0 -0.5747 4.5123 View CSV PDB
5.5 -0.6234 4.5123 View CSV PDB
6.0 -0.6629 4.5123 View CSV PDB
6.5 -0.6864 4.5123 View CSV PDB
7.0 -0.6932 4.5123 View CSV PDB
7.5 -0.6883 4.5122 View CSV PDB
8.0 -0.6759 4.5122 View CSV PDB
8.5 -0.6563 4.5121 View CSV PDB
9.0 -0.6292 4.5119 View CSV PDB