Project name: a3ee50847858468

Status: done

Started: 2026-03-12 23:13:51
Chain sequence(s) A: WKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSEVQTIGQIELCLTKQDQQLQNCTSRGLRVCEDGPVFYPPPK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:04:34)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:42:01)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:42:02)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:42:03)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:42:04)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:42:05)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:42:06)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:42:07)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:42:08)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:42:09)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:42:10)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:42:11)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:42:12)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:42:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:42:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:42:17)
Show buried residues

Minimal score value
-3.8366
Maximal score value
1.8902
Average score
-0.8675
Total score value
-170.0373

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
34 W A -0.4296
35 K A -2.2729
36 K A -2.3892
37 L A 0.0000
38 I A 0.0000
39 M A 0.0000
40 V A 0.0000
41 Q A 0.0000
42 H A 0.0000
43 W A 0.0000
44 P A 0.0000
45 E A -1.7762
46 T A 0.0000
47 V A 0.0000
48 C A -0.8758
49 E A -1.9664
50 K A -2.2086
51 I A -1.0617
52 Q A 0.0000
53 N A -1.7210
54 D A 0.0000
55 C A 0.0000
56 R A -3.2056
57 D A -3.0253
58 P A 0.0000
59 P A -1.4139
60 D A -2.2321
61 Y A -1.6782
62 W A 0.0000
63 T A 0.0000
64 I A 0.0000
65 H A 0.0000
66 G A 0.0000
67 L A 0.0000
68 W A -0.5759
69 P A 0.0000
70 D A -1.9930
71 K A -2.7964
72 S A -2.0581
73 E A -2.8064
74 G A -1.7729
75 C A -1.5943
76 N A -1.6936
77 R A -1.3166
78 S A -0.8751
79 W A -0.3631
80 P A -0.6051
81 F A -1.2261
82 N A -2.0460
83 L A -2.5129
84 E A -3.5238
85 E A -3.3525
86 I A 0.0000
87 K A -3.7630
88 D A -3.3255
89 L A 0.0000
90 L A -1.9019
91 P A -1.4915
92 E A -1.0426
93 M A 0.0000
94 R A -1.6036
95 A A -0.9288
96 Y A 0.0851
97 W A 0.0000
98 P A 0.0000
99 D A 0.0000
100 V A 0.0000
101 I A 0.0000
102 H A -0.3370
103 S A 0.0000
104 F A -0.2166
105 P A -0.7186
106 N A -1.8286
107 R A -2.3245
108 S A -1.9023
109 R A -2.6464
110 F A 0.0000
111 W A 0.0000
112 K A -2.1343
113 H A -1.7772
114 E A 0.0000
115 W A 0.0000
116 E A -1.6922
117 K A -1.8199
118 H A 0.0000
119 G A 0.0000
120 T A 0.0000
121 C A -1.1610
122 A A 0.0000
123 A A 0.0000
124 Q A -0.9979
125 V A -0.4839
126 D A -1.1196
127 A A -0.8637
128 L A 0.0000
129 N A -1.6001
130 S A -1.6366
131 Q A 0.0000
132 K A -3.2463
133 K A -2.3688
134 Y A 0.0000
135 F A 0.0000
136 G A -1.8962
137 R A -2.1964
138 S A 0.0000
139 L A -1.5047
140 E A -3.3370
141 L A 0.0000
142 Y A -2.3840
143 R A -3.7664
144 E A -3.8366
145 L A 0.0000
146 D A -3.0317
147 L A 0.0000
148 N A -1.3121
149 S A -0.9597
150 V A 0.0000
151 L A 0.0000
152 L A 0.0247
153 K A -1.3436
154 L A 0.0000
155 G A -0.4476
156 I A -0.6391
157 K A -1.6202
158 P A 0.0000
159 S A 0.6835
160 I A 1.8902
161 N A 0.2042
162 Y A 1.5816
163 Y A 0.6581
164 Q A -0.9961
165 V A -0.8947
166 A A -1.1575
167 D A -1.6812
168 F A 0.0000
169 K A -2.4515
170 D A -2.9197
171 A A 0.0000
172 L A 0.0000
173 A A -1.2470
174 R A -1.7470
175 V A -0.0357
176 Y A 0.8862
177 G A -0.1532
178 V A 0.0000
179 I A -0.4450
180 P A 0.0000
181 K A -0.4485
182 I A -0.0103
183 Q A 0.0000
184 C A 0.0000
185 L A 0.5719
186 P A -0.0560
187 P A -0.3801
188 S A -0.8559
192 E A -1.5033
193 V A 0.7245
194 Q A -0.2186
195 T A 0.0000
196 I A 0.0000
197 G A 0.0000
198 Q A 0.0000
199 I A 0.0000
200 E A 0.0000
201 L A 0.0000
202 C A 0.0000
203 L A 0.0000
204 T A -2.5441
205 K A -3.0587
206 Q A 0.0000
207 D A -3.2125
208 Q A -2.4122
209 Q A -2.1015
210 L A 0.0000
211 Q A -1.7583
212 N A -2.0769
213 C A 0.0000
214 T A -0.5695
235 S A -0.4262
236 R A -0.8484
237 G A -0.6695
238 L A -0.3641
239 R A -0.9586
240 V A 0.4761
241 C A -0.3821
242 E A -1.9350
243 D A -2.2178
244 G A 0.0000
245 P A -0.6491
246 V A 0.0000
247 F A 0.9922
248 Y A 0.0000
249 P A -0.8047
250 P A 0.0000
251 P A -1.4681
252 K A -2.5810
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.8675 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.8675 View CSV PDB
model_10 -0.8778 View CSV PDB
model_8 -0.9038 View CSV PDB
model_5 -0.9164 View CSV PDB
model_11 -0.9177 View CSV PDB
model_1 -0.932 View CSV PDB
CABS_average -0.9409 View CSV PDB
model_6 -0.9512 View CSV PDB
input -0.9587 View CSV PDB
model_0 -0.9614 View CSV PDB
model_9 -0.9802 View CSV PDB
model_7 -0.9894 View CSV PDB
model_2 -0.9907 View CSV PDB
model_4 -1.0032 View CSV PDB