Project name: a4105c4e1c2d032

Status: done

Started: 2026-07-15 01:56:53
Chain sequence(s) A: QVQLVQSGGGTVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVSVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASSGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQIT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a4105c4e1c2d032/tmp/folded.pdb                (00:03:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:41)
Show buried residues

Minimal score value
-3.4066
Maximal score value
0.4809
Average score
-0.8108
Total score value
-194.5827

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4816
2 V A -0.8780
3 Q A -1.0827
4 L A 0.0000
5 V A 0.4016
6 Q A 0.0000
7 S A -0.7035
8 G A -0.9547
9 G A -0.8175
10 G A -0.6599
11 T A -0.5664
12 V A 0.0000
13 Q A -2.4446
14 P A -2.5803
15 G A -2.4003
16 R A -2.9554
17 S A -2.1682
18 L A -1.4027
19 R A -1.7925
20 L A 0.0000
21 S A -0.7292
22 C A 0.0000
23 K A -1.6748
24 A A 0.0000
25 S A -1.1322
26 G A -0.9956
27 Y A -0.6788
28 T A -0.7000
29 F A 0.0000
30 T A -1.5958
31 R A -2.1794
32 Y A -1.0041
33 T A -0.7457
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6976
40 A A -1.1561
41 P A -1.1489
42 G A -1.4486
43 K A -2.3358
44 G A -1.5118
45 L A 0.0000
46 E A -0.7186
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 Y A -0.0435
51 I A 0.0000
52 N A -1.2130
53 P A 0.0000
54 S A -1.7548
55 R A -2.1548
56 G A -1.1337
57 Y A -0.4212
58 T A -0.2455
59 N A -0.7256
60 Y A -1.3584
61 N A 0.0000
62 Q A -2.7214
63 K A -3.0004
64 V A 0.0000
65 K A -3.4066
66 D A -3.3167
67 R A -2.4869
68 F A 0.0000
69 T A -1.1304
70 I A 0.0000
71 S A -0.6075
72 R A -1.8008
73 D A -1.9894
74 N A -1.9814
75 S A -1.7399
76 K A -2.8231
77 N A -2.4037
78 T A 0.0000
79 A A 0.0000
80 F A -0.7669
81 L A 0.0000
82 Q A -1.1227
83 M A 0.0000
84 D A -2.3823
85 S A -2.2475
86 L A 0.0000
87 R A -3.0708
88 P A -2.1128
89 E A -2.5253
90 D A 0.0000
91 T A -0.9933
92 G A 0.0000
93 V A 0.1485
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 Y A -0.3791
100 Y A -1.0907
101 D A -2.4495
102 D A -2.4482
103 H A -1.4094
104 Y A -0.4237
105 C A 0.0000
106 L A 0.0000
107 D A -0.2384
108 Y A 0.0374
109 W A -0.3826
110 G A 0.0000
111 Q A -1.3162
112 G A -0.7122
113 T A 0.0000
114 P A -0.3747
115 V A 0.0000
116 S A -0.8697
117 V A 0.0000
118 S A -1.4058
119 S A -1.4970
120 G A -1.2267
121 G A -1.1044
122 G A -1.1022
123 G A -1.0913
124 S A -0.8813
125 G A -1.0727
126 G A -1.3127
127 G A -1.3439
128 G A -1.1921
129 S A -1.0176
130 G A -1.3804
131 G A -1.6777
132 G A -1.2033
133 G A -1.0774
134 S A -0.8833
135 D A -1.1891
136 I A -0.9509
137 Q A -1.3096
138 M A 0.0000
139 T A -0.8445
140 Q A 0.0000
141 S A -0.6336
142 P A -0.6677
143 S A -0.9857
144 S A -1.1562
145 L A -0.6032
146 S A -0.6025
147 A A -0.7452
148 S A -0.9174
149 S A -1.0968
150 G A -1.6550
151 D A -2.1134
152 R A -2.4980
153 V A 0.0000
154 T A -0.5850
155 I A 0.0000
156 T A -0.5623
157 C A 0.0000
158 S A -1.1790
159 A A 0.0000
160 S A -1.0096
161 S A -0.8423
162 S A -0.6785
163 V A 0.0000
164 S A -0.0729
165 Y A 0.4809
166 M A 0.0000
167 N A 0.0000
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 T A -1.3286
173 P A -0.9712
174 G A -1.4955
175 K A -2.5037
176 A A -1.6167
177 P A 0.0000
178 K A -1.8713
179 R A -0.7973
180 W A -0.5939
181 I A 0.0000
182 Y A -0.1098
183 D A 0.0000
184 T A 0.0000
185 S A -0.7412
186 K A -1.1984
187 L A -0.3253
188 A A 0.0000
189 S A -0.4394
190 G A -0.4397
191 V A -0.2633
192 P A -0.2688
193 S A -0.3752
194 R A -0.7743
195 F A 0.0000
196 S A -0.4905
197 G A 0.0000
198 S A -0.8572
199 G A -1.1097
200 S A -0.9829
201 G A -0.9420
202 T A -1.2390
203 D A -2.1596
204 Y A 0.0000
205 T A -0.6950
206 F A 0.0000
207 T A -0.5736
208 I A 0.0000
209 S A -1.3326
210 S A -1.5752
211 L A 0.0000
212 Q A -1.5490
213 P A -1.4416
214 E A -1.9414
215 D A 0.0000
216 I A -0.8992
217 A A 0.0000
218 T A 0.0000
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 Q A 0.0000
223 Q A 0.0000
224 W A 0.1213
225 S A -0.1893
226 S A -0.7809
227 N A -1.3099
228 P A -0.9978
229 F A 0.0000
230 T A -0.5931
231 F A -0.3224
232 G A 0.0000
233 Q A -1.6269
234 G A 0.0000
235 T A 0.0000
236 K A -2.1407
237 L A 0.0000
238 Q A -1.1639
239 I A -0.2101
240 T A -0.0511
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.9205 1.7114 View CSV PDB
4.5 -0.9525 1.7114 View CSV PDB
5.0 -0.9868 1.7114 View CSV PDB
5.5 -1.0179 1.7114 View CSV PDB
6.0 -1.0387 1.7114 View CSV PDB
6.5 -1.044 1.7114 View CSV PDB
7.0 -1.0358 1.7114 View CSV PDB
7.5 -1.0196 1.7114 View CSV PDB
8.0 -0.9985 1.7114 View CSV PDB
8.5 -0.972 1.7114 View CSV PDB
9.0 -0.9389 1.7114 View CSV PDB