Project name: a474fb1322eccdd

Status: done

Started: 2026-03-11 18:55:39
Chain sequence(s) A: MDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSIGGGGSFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:05)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:07:14)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a474fb1322eccdd/tmp/folded.pdb                (00:07:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:13:31)
Show buried residues

Minimal score value
-5.4996
Maximal score value
3.3814
Average score
-0.9212
Total score value
-295.7065

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1255
2 D A -1.5851
3 D A -2.8361
4 R A -2.5741
5 F A -0.4868
6 N A -2.0888
7 D A -1.8243
8 V A 0.5575
9 N A -0.6643
10 T A -0.4307
11 I A 0.4370
12 N A -2.0157
13 K A -2.7596
14 K A -2.6676
15 Q A -1.8153
16 F A 0.3945
17 T A -0.9607
18 E A -2.0313
19 E A -2.2993
20 E A -0.9208
21 F A 0.6436
22 S A -0.8657
23 R A -1.8075
24 L A 0.2797
25 I A -0.0494
26 N A -1.3464
27 S A -0.9119
28 M A -0.4057
29 L A -0.8633
30 K A -2.3804
31 E A -2.9382
32 Y A -1.0364
33 I A -1.3496
34 E A -4.1832
35 D A -4.8150
36 N A -4.6815
37 K A -5.2708
38 K A -5.4996
39 D A -5.4214
40 K A -4.7907
41 H A -3.6133
42 P A -2.3142
43 T A -1.7483
44 Q A -2.3062
45 K A -2.4441
46 T A -1.5529
47 T A -1.3262
48 P A -1.4496
49 K A -2.0027
50 P A -1.2487
51 T A -1.0209
52 T A -1.0790
53 P A -1.2285
54 K A -2.1025
55 Q A -1.6971
56 I A -0.2783
57 N A -1.8571
58 D A -2.2352
59 G A -1.7093
60 T A -1.8394
61 S A -1.9500
62 D A -2.8572
63 K A -2.9765
64 T A -2.0237
65 S A -1.9724
66 D A -2.4828
67 T A -1.2780
68 H A -1.3289
69 T A -0.5590
70 I A 0.3408
71 K A -1.8029
72 R A -2.2150
73 T A -1.5099
74 T A -1.3786
75 P A -1.4455
76 K A -2.0013
77 P A -1.2416
78 T A -0.9841
79 T A -1.0669
80 P A -1.2337
81 K A -2.1217
82 Q A -1.6872
83 I A -0.2365
84 N A -1.8580
85 D A -2.2484
86 G A -1.6994
87 T A -1.7153
88 S A -1.9161
89 D A -2.8499
90 K A -2.9315
91 T A -2.0019
92 S A -1.9697
93 D A -2.4479
94 T A -1.2746
95 H A -1.2892
96 T A -0.5995
97 I A 0.3072
98 K A -1.8006
99 R A -2.1992
100 T A -1.4867
101 T A -1.4360
102 P A -1.4731
103 K A -2.0058
104 P A -1.2493
105 T A -1.0773
106 T A -1.1080
107 P A -1.2204
108 K A -1.9701
109 Q A -1.7280
110 I A -0.3950
111 N A -1.8498
112 D A -2.2560
113 G A -1.7429
114 T A -1.9428
115 S A -2.0159
116 D A -3.0955
117 K A -3.1474
118 P A -1.3934
119 K A -2.0881
120 S A 0.0647
121 I A 2.3659
122 A A 2.1034
123 D A 1.4528
124 I A 2.3562
125 F A 3.2637
126 L A 2.9940
127 I A 2.4357
128 N A -0.0074
129 K A -0.5148
130 P A -0.8570
131 K A -1.2886
132 V A 1.5674
133 P A 1.7715
134 L A 2.5946
135 W A 2.8735
136 I A 3.3814
137 V A 2.9117
138 N A 1.6609
139 P A 1.8714
140 L A 2.8831
141 Y A 2.5614
142 Y A 1.9391
143 M A 1.8015
144 V A 2.2476
145 E A 0.3579
146 K A 0.4975
147 F A 1.8066
148 V A 1.9962
149 Q A 0.5704
150 I A 1.5626
151 M A 2.0173
152 G A 1.3526
153 Y A 1.7667
154 L A 1.6991
155 L A 0.9624
156 E A -1.6247
157 D A -2.7331
158 D A -3.3990
159 D A -2.9337
160 T A -1.3628
161 L A -0.2087
162 E A -0.7365
163 L A 1.0444
164 N A -0.4756
165 L A 0.8021
166 P A 0.2456
167 K A -0.5597
168 Y A 1.0499
169 Y A 1.1940
170 Y A 0.8559
171 D A -0.9302
172 K A -1.9499
173 S A -0.6693
174 I A 0.6092
175 G A -0.8860
176 G A -0.7508
177 G A -0.9666
178 G A -1.1340
179 S A -0.9381
180 F A -0.9540
181 D A -2.0396
182 A A -1.8634
183 S A -2.1149
184 N A -2.4188
185 F A 0.0000
186 K A -2.3644
187 D A -1.4437
188 F A -0.6023
189 S A -0.7038
190 S A -1.0799
191 I A 0.0000
192 A A -0.5390
193 S A -0.6271
194 A A -0.7061
195 S A -0.4608
196 S A 0.0000
197 S A -0.1350
198 W A 0.0000
199 Q A -0.9950
200 N A 0.0000
201 Q A -1.8019
202 S A -1.3427
203 G A -1.1450
204 S A 0.0000
205 T A -0.6507
206 M A 0.0000
207 I A -0.0231
208 I A 0.0000
209 Q A -1.5353
210 V A 0.0000
211 D A -0.7951
212 S A 0.2986
213 F A 1.0531
214 G A 0.0000
215 N A -1.3786
216 V A 0.0000
217 S A -1.1755
218 G A -0.6295
219 Q A -0.4823
220 Y A 0.0000
221 V A -0.8274
222 N A 0.0000
223 R A -2.2209
224 A A -1.7758
225 Q A -1.8908
226 G A -1.3923
227 T A -1.1576
228 G A -1.5864
229 C A 0.0000
230 Q A -2.2696
231 N A -1.9958
232 S A -1.3683
233 P A -0.9608
234 Y A 0.0000
235 P A -0.7029
236 L A 0.0000
237 T A -0.9788
238 G A -1.3016
239 R A -2.0497
240 V A 0.0000
241 N A -1.0589
242 G A -0.5870
243 T A -0.1148
244 F A 0.9451
245 I A 0.0000
246 A A -0.4747
247 F A 0.0000
248 S A -0.6206
249 V A 0.0000
250 G A -1.0259
251 W A 0.0000
252 N A -2.4338
253 N A -1.6720
254 S A -1.1772
255 T A -1.5075
256 E A -2.5497
257 N A -2.7704
258 C A -1.7942
259 N A -2.1693
260 S A -0.9544
261 A A -0.3702
262 T A 0.0000
263 G A -0.4881
264 W A 0.0000
265 T A -0.0361
266 G A 0.0000
267 Y A 1.0667
268 A A 0.0000
269 Q A -1.0631
270 V A -1.4784
271 N A -1.9187
272 G A -1.7255
273 N A -2.1929
274 N A -1.7966
275 T A 0.0000
276 E A -0.8396
277 I A 0.0000
278 V A 0.2837
279 T A 0.0000
280 S A -0.8843
281 W A -1.0776
282 N A -0.7740
283 L A -0.1016
284 A A 0.0664
285 Y A -0.4004
286 E A -1.8055
287 G A -1.0484
288 G A -1.0669
289 S A -0.9107
290 G A -1.0489
291 P A -0.7033
292 A A 0.1749
293 I A 1.0768
294 E A -0.4373
295 Q A -1.6029
296 G A -1.6180
297 Q A -1.7601
298 D A -1.1607
299 T A -0.7559
300 F A 0.0000
301 Q A -1.0591
302 Y A 0.0000
303 V A 0.2617
304 P A -0.4423
305 T A -0.7267
306 T A -1.5852
307 E A -3.2626
308 N A -2.8266
309 K A -2.3313
310 S A -0.6625
311 L A 0.8013
312 L A 0.7166
313 K A -1.5654
314 D A -2.5718
315 T A -2.0734
316 H A -2.7393
317 H A -2.7109
318 H A -2.6636
319 H A -2.6748
320 H A -2.3979
321 H A -1.8801
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4041 6.6331 View CSV PDB
4.5 -0.4966 6.6331 View CSV PDB
5.0 -0.6009 6.6331 View CSV PDB
5.5 -0.6931 6.6331 View CSV PDB
6.0 -0.7494 6.6331 View CSV PDB
6.5 -0.7611 6.6331 View CSV PDB
7.0 -0.7395 6.6643 View CSV PDB
7.5 -0.6996 6.7229 View CSV PDB
8.0 -0.6483 6.7851 View CSV PDB
8.5 -0.584 6.8532 View CSV PDB
9.0 -0.5037 6.9281 View CSV PDB