Project name: mi2699_2VY0_25C_conf1

Status: done

Started: 2026-05-22 14:58:07
Chain sequence(s) A: VPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a4e282e9d2dfc5/tmp/folded.pdb                 (00:06:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:13:02)
Show buried residues

Minimal score value
-3.3853
Maximal score value
1.5972
Average score
-0.6562
Total score value
-172.5703

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
35 V A 1.3680
36 P A 0.2677
37 E A -0.4479
38 V A -0.0136
39 I A -0.6299
40 E A -1.9400
41 I A -1.0591
42 D A -1.2644
43 G A -1.5177
44 K A -1.3328
45 Q A -1.0917
46 W A 0.0000
47 R A -0.5242
48 L A 0.6973
49 I A 1.5972
50 W A 0.0000
51 H A 0.1171
52 D A -1.0270
53 E A -1.2040
54 F A 0.0000
55 E A -2.7084
56 G A -2.0749
57 S A -1.5804
58 E A -2.1980
59 V A -1.4056
60 N A -2.1032
61 K A -2.8673
62 E A -2.7600
63 Y A -1.6309
64 W A 0.0000
65 T A -1.2719
66 F A -0.9285
67 E A -1.2083
68 K A -1.8407
69 G A 0.0000
70 N A 0.0000
71 G A 0.0000
72 I A 0.4826
73 A A 0.6507
74 Y A 1.5135
75 G A 0.7204
76 I A 0.9204
77 P A 0.0550
78 G A -0.5680
79 W A -0.1398
80 G A -0.9046
81 N A -1.7254
82 G A -1.3126
83 E A -1.1696
84 L A 0.7967
85 E A 0.3878
86 Y A 0.0970
87 Y A 0.0000
88 T A 0.0000
89 E A -1.6261
90 N A -1.5633
91 N A -1.1140
92 T A -0.6925
93 Y A -0.0308
94 I A 0.0000
95 V A -0.4864
96 N A -1.5041
97 G A -1.6005
98 T A -1.0566
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A 0.0000
103 A A 0.0000
104 R A -1.2805
105 K A -1.2053
106 E A -1.0763
107 I A 1.5219
108 I A 0.9610
109 T A -0.1073
110 D A -1.6654
111 P A -1.5963
112 N A -1.9996
113 E A -1.5729
114 G A -1.1623
115 T A 0.3077
116 F A 0.0000
117 L A 1.3677
118 Y A 0.4006
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.8299
123 L A 0.0000
124 K A -0.4614
125 T A 0.0000
126 E A -1.3857
127 G A -1.6683
128 K A -2.2918
129 V A -1.4570
130 E A -1.9531
131 F A 0.0000
132 S A -1.0232
133 P A -0.7347
134 P A -0.1919
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.4339
139 A A 0.0000
140 R A -1.2607
141 I A 0.0000
142 K A -1.7421
143 L A 0.0000
144 P A 0.0000
145 K A -2.5749
146 G A -1.8974
147 K A -2.4003
148 G A 0.0000
149 L A 0.0000
150 W A 0.1286
151 P A 0.0000
152 A A -0.0874
153 F A 0.0000
154 W A -0.0387
155 M A 0.0000
156 L A 0.0000
157 G A 0.0000
158 S A -1.0946
159 N A -1.0905
160 I A -0.7241
161 R A -2.1294
162 E A -2.0675
163 V A -0.0471
164 G A -0.2034
165 W A 0.6128
166 P A 0.3780
167 N A -0.5322
168 C A 0.0000
169 G A 0.0000
170 E A -0.2721
171 I A 0.0000
172 D A -0.3412
173 I A 0.0000
174 M A 0.0000
175 E A -0.3438
176 F A 0.0000
177 L A -0.4513
178 G A -1.4657
179 H A -2.1430
180 E A -1.9791
181 P A -1.8041
182 R A -1.1311
183 T A 0.0000
184 I A 0.0000
185 H A -0.7457
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A -0.7647
190 G A 0.0000
191 P A -0.7481
192 G A -0.8640
193 Y A 0.0000
194 S A -1.0063
195 G A -1.2020
196 S A -1.2795
197 K A -1.9683
198 G A -1.2619
199 I A -0.7560
200 T A -1.1705
201 R A -1.6131
202 A A -0.7466
203 Y A -0.2051
204 T A -0.5704
205 L A 0.0000
206 P A -1.1770
207 E A -2.0986
208 G A -1.2215
209 V A -0.4879
210 P A -1.3637
211 D A -1.7288
212 F A 0.0000
213 T A -2.2616
214 E A -3.1595
215 D A -2.7362
216 F A -1.5711
217 H A -1.3865
218 V A -1.0800
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A -0.9936
225 P A -1.9450
226 D A -2.9644
227 K A -2.3735
228 I A 0.0000
229 K A -0.8716
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.9380
234 G A -1.1111
235 T A -0.3994
236 F A 0.0010
237 Y A 0.0000
238 H A -0.9042
239 E A -1.5220
240 V A 0.0000
241 T A -2.3592
242 K A -3.0918
243 E A -3.3853
244 Q A -2.1637
245 V A 0.0000
246 E A -2.9860
247 A A -1.3731
248 M A -0.7463
249 G A -1.2836
250 Y A -1.0358
251 E A -2.0924
252 W A 0.0000
253 V A -1.3487
254 F A 0.0000
255 D A -2.4408
256 K A -1.4363
257 P A -1.1717
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A 0.0000
264 L A 0.0000
265 A A 0.0000
266 V A 0.0000
267 G A -0.2482
268 G A 0.3927
269 Y A 1.4633
270 W A 1.5928
271 P A 0.0000
272 G A -0.4722
273 N A -1.5816
274 P A -1.5127
275 D A -1.6374
276 A A -0.6862
277 T A -0.4868
278 T A 0.0000
279 P A -0.9290
280 F A -0.9143
281 P A -0.9892
282 A A 0.0000
283 K A -1.3905
284 M A 0.0000
285 V A 0.0000
286 V A 0.0000
287 D A -1.3088
288 Y A 0.0000
289 V A 0.0000
290 R A -0.0540
291 V A 0.0000
292 Y A 0.0000
293 S A 0.8692
294 F A 1.2795
295 V A 0.9380
296 S A -0.2704
297 G A -0.8199
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1361 4.1995 View CSV PDB
4.5 -0.2101 4.1995 View CSV PDB
5.0 -0.3061 4.1995 View CSV PDB
5.5 -0.4081 4.1995 View CSV PDB
6.0 -0.4988 4.1995 View CSV PDB
6.5 -0.563 4.1995 View CSV PDB
7.0 -0.5943 4.1994 View CSV PDB
7.5 -0.5997 4.1994 View CSV PDB
8.0 -0.5904 4.1992 View CSV PDB
8.5 -0.5721 4.1985 View CSV PDB
9.0 -0.5461 4.1963 View CSV PDB