Project name: a64dab3e294477

Status: done

Started: 2026-07-18 22:11:13
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGGTFWFGAFTWVRQAPGQGLEWMGGIIPIFGLTNLAQNFQGRVTITADESTSTVYMELSSLRSEDTAVYYCARSSRIYDLNPSLTAYYDMDVWGQGTMVTVSSGGGSSGGGGSGGGGGAQSVLTQPPSVSAAPGQKVTISCSGSSSDIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAWVFGGGTKLTVL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a64dab3e294477/tmp/folded.pdb                 (00:02:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:04)
Show buried residues

Minimal score value
-3.0017
Maximal score value
2.3608
Average score
-0.5311
Total score value
-134.8993

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6360
2 V A -1.3600
3 Q A -1.4790
4 L A 0.0000
5 V A 0.4598
6 Q A 0.0000
7 S A -0.5199
8 G A -0.5505
9 A A 0.0353
10 E A -0.1570
11 V A 0.8591
12 K A -1.0333
13 K A -2.2765
14 P A -2.3181
15 G A -1.6006
16 S A -1.2728
17 S A -1.4459
18 V A 0.0000
19 K A -2.2255
20 V A 0.0000
21 S A -0.5611
22 C A 0.0000
23 K A -0.6654
24 A A 0.0000
25 S A -0.9454
26 G A -1.3317
27 G A -0.7432
28 T A 0.4751
29 F A 0.4141
30 W A 1.5843
31 F A 2.3608
32 G A 0.0000
33 A A 0.0000
34 F A 0.0000
35 T A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.3917
39 Q A -0.6341
40 A A -1.0601
41 P A -1.0571
42 G A -1.2082
43 Q A -1.8171
44 G A -1.3992
45 L A 0.0000
46 E A -0.7652
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 G A 0.0000
51 I A 0.0000
52 I A 0.0000
53 P A 0.0000
54 I A 1.3556
55 F A 1.2969
56 G A 0.2809
57 L A 0.3897
58 T A 0.0809
59 N A -0.3328
60 L A -0.7398
61 A A 0.0000
62 Q A -2.1372
63 N A -2.2359
64 F A 0.0000
65 Q A -2.2109
66 G A -1.4913
67 R A -1.2328
68 V A 0.0000
69 T A -0.9147
70 I A 0.0000
71 T A -0.4946
72 A A -0.7414
73 D A -1.6284
74 E A -2.0459
75 S A -1.3219
76 T A -1.0918
77 S A -1.1569
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6812
81 M A 0.0000
82 E A -1.8021
83 L A 0.0000
84 S A -1.1875
85 S A -1.1826
86 L A 0.0000
87 R A -3.0017
88 S A -2.4560
89 E A -2.8710
90 D A 0.0000
91 T A -0.8648
92 A A 0.0000
93 V A 0.1871
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 S A 0.0000
100 S A 0.3647
101 R A 0.4396
102 I A 1.3169
103 Y A 1.3479
104 D A 0.3544
105 L A 1.3101
106 N A 0.2125
107 P A 0.2314
108 S A 0.2575
109 L A 1.2463
110 T A 0.7135
111 A A 0.3806
112 Y A 0.0000
113 Y A 0.4777
114 D A 0.0000
115 M A 0.0000
116 D A -0.9308
117 V A -0.8576
118 W A -0.4928
119 G A 0.0000
120 Q A -1.0166
121 G A -0.3840
122 T A 0.0000
123 M A 0.3347
124 V A 0.0000
125 T A -0.2542
126 V A 0.0000
127 S A -1.3091
128 S A -1.5961
129 G A -1.2199
130 G A -1.0764
131 G A -1.0294
132 S A -0.8873
133 S A -0.7942
134 G A -1.0468
135 G A -1.1350
136 G A -1.1360
137 G A -1.1707
138 S A -1.0254
139 G A -1.4422
140 G A -1.4174
141 G A -1.6578
142 G A -1.5510
143 G A -1.7301
144 A A -1.2710
145 Q A -1.2538
146 S A -0.6009
147 V A 0.4764
148 L A 0.0000
149 T A -0.1978
150 Q A -0.5278
151 P A -0.5595
152 P A -0.8347
153 S A -0.7949
154 V A -0.3132
155 S A -0.0193
156 A A -0.2741
157 A A -0.2996
158 P A -1.0529
159 G A -1.7584
160 Q A -2.3680
161 K A -2.4977
162 V A 0.0000
163 T A -0.4807
164 I A 0.0000
165 S A -0.3634
166 C A 0.0000
167 S A -0.3633
168 G A -0.2443
169 S A -0.5012
170 S A -0.9321
171 S A -0.7047
172 D A 0.0000
173 I A 0.0000
174 G A -1.1242
175 N A -1.4088
176 N A -0.4499
177 Y A 0.3704
178 V A 0.0000
179 S A 0.0000
180 W A 0.0000
181 Y A 0.0000
182 Q A 0.0000
183 Q A 0.0000
184 L A -0.4102
185 P A -0.5401
186 G A -0.5978
187 T A -0.6137
188 A A -0.6138
189 P A 0.0000
190 K A -1.1270
191 L A 0.0000
192 L A 0.0000
193 I A 0.0000
194 Y A -0.8237
195 D A -0.7578
196 N A -1.1846
197 N A -2.1959
198 K A -2.4841
199 R A -2.0327
200 P A -1.0495
201 S A -0.7119
202 G A -0.8136
203 I A -1.0252
204 P A -1.2835
205 D A -2.3416
206 R A -1.6074
207 F A 0.0000
208 S A -1.4315
209 G A 0.0000
210 S A -1.1630
211 K A -1.0346
212 S A -0.8143
213 G A -1.0447
214 T A -0.9062
215 S A -0.6798
216 A A 0.0000
217 T A -0.5698
218 L A 0.0000
219 G A -0.6340
220 I A 0.0000
221 T A -1.8362
222 G A -1.6341
223 L A 0.0000
224 Q A -1.7132
225 T A -0.9010
226 G A -1.1091
227 D A 0.0000
228 E A -1.5435
229 A A 0.0000
230 D A -1.4281
231 Y A 0.0000
232 Y A 0.0000
233 C A 0.0000
234 G A 0.0000
235 T A 0.0000
236 W A 0.1158
237 D A 0.0000
238 S A -0.2791
239 S A -0.1600
240 L A 0.0549
241 S A 0.0121
242 A A 0.0000
243 W A 0.0000
244 V A 0.0000
245 F A 0.0000
246 G A 0.0000
247 G A -1.1103
248 G A -1.0966
249 T A 0.0000
250 K A -1.8116
251 L A 0.0000
252 T A -0.3773
253 V A -0.0003
254 L A 1.4309
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3236 5.2834 View CSV PDB
4.5 -0.3501 5.2834 View CSV PDB
5.0 -0.3802 5.2834 View CSV PDB
5.5 -0.4086 5.2834 View CSV PDB
6.0 -0.4286 5.2834 View CSV PDB
6.5 -0.4347 5.2834 View CSV PDB
7.0 -0.4265 5.2834 View CSV PDB
7.5 -0.4089 5.2834 View CSV PDB
8.0 -0.3859 5.2834 View CSV PDB
8.5 -0.3588 5.2834 View CSV PDB
9.0 -0.328 5.2834 View CSV PDB