Project name: a81658ed0f6311e

Status: done

Started: 2026-07-15 05:55:08
Chain sequence(s) A: QVQLQQPGAELVRPGASVKLSCKASGYTFSTYWMHWVKQRPGQGLEWIGDIHPGGGNTYYNERFKRKASLTVDTSSNTAYMQLSSLTSEDSAVYYCARHGHYFDYWGQGTTITVSS
B: DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGSVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTIANLEQEDIATYFCQQGDTLPFTFGSGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:55)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a81658ed0f6311e/tmp/folded.pdb                (00:02:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:33)
Show buried residues

Minimal score value
-3.5949
Maximal score value
0.86
Average score
-0.7392
Total score value
-164.8393

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6630
2 V A 0.0000
3 Q A -2.1873
4 L A 0.0000
5 Q A -2.2578
6 Q A 0.0000
7 P A -1.1389
8 G A -1.0668
9 A A -0.4071
10 E A -0.6236
11 L A 0.6425
12 V A -0.4217
13 R A -1.7921
14 P A -1.4299
15 G A -1.1603
16 A A -0.9300
17 S A -1.1484
18 V A 0.0000
19 K A -2.1537
20 L A 0.0000
21 S A -0.9121
22 C A 0.0000
23 K A -1.9491
24 A A 0.0000
25 S A -1.4865
26 G A -1.2149
27 Y A -0.5267
28 T A -0.1946
29 F A 0.0000
30 S A -0.3888
31 T A -0.0921
32 Y A 0.2462
33 W A -0.0953
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A -0.6483
39 Q A 0.0000
40 R A -1.7058
41 P A -1.1895
42 G A -1.3884
43 Q A -1.9404
44 G A -1.2622
45 L A 0.0000
46 E A -1.1336
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 D A 0.0000
51 I A 0.0000
52 H A -0.6738
53 P A 0.0000
54 G A -0.9751
55 G A -1.2872
56 G A -1.3509
57 N A -1.4168
58 T A -0.1155
59 Y A 0.8600
60 Y A -0.5070
61 N A 0.0000
62 E A -3.4179
63 R A -3.5949
64 F A 0.0000
65 K A -3.5855
66 R A -3.4452
67 K A -2.3869
68 A A 0.0000
69 S A -1.2751
70 L A 0.0000
71 T A -0.3630
72 V A -0.4691
73 D A -0.9716
74 T A -0.8173
75 S A -0.6448
76 S A -0.8728
77 N A -1.2087
78 T A 0.0000
79 A A 0.0000
80 Y A -0.5913
81 M A 0.0000
82 Q A -1.5775
83 L A 0.0000
84 S A -1.1839
85 S A -1.0084
86 L A 0.0000
87 T A -1.2827
88 S A -1.4821
89 E A -2.0567
90 D A 0.0000
91 S A -0.7834
92 A A 0.0000
93 V A -0.1754
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 H A -0.0604
100 G A -0.2401
101 H A -0.2984
102 Y A -0.0297
103 F A 0.0000
104 D A 0.0000
105 Y A -0.2182
106 W A -0.6330
107 G A 0.0000
108 Q A -1.9452
109 G A 0.0000
110 T A 0.0000
111 T A -0.3429
112 I A 0.0000
113 T A -0.2614
114 V A 0.0000
115 S A -0.5988
116 S A -0.7755
1 D B -2.2394
2 I B 0.0000
3 Q B -2.2139
4 M B 0.0000
5 T B -1.1956
6 Q B 0.0000
7 T B -0.4969
8 T B -0.4177
9 S B -0.6738
10 S B -1.0422
11 L B -0.7965
12 S B -1.2131
13 A B 0.0000
14 S B -1.3622
15 L B -0.9849
16 G B -1.7718
17 D B -2.1205
18 R B -2.6189
19 V B 0.0000
20 T B -0.5643
21 I B 0.0000
22 S B -0.8627
23 C B 0.0000
24 R B -2.8518
25 A B 0.0000
26 S B -2.2590
27 Q B -2.7792
28 D B -2.9141
29 I B 0.0000
30 S B -1.1695
31 N B -0.9839
32 Y B -0.2300
33 L B 0.0000
34 N B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B -1.1812
39 K B -1.9510
40 P B -1.5968
41 D B -2.4091
42 G B -1.6560
43 S B -1.5119
44 V B 0.0000
45 K B -0.9998
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -0.2579
50 Y B -0.2645
51 T B 0.0000
52 S B -1.0153
53 R B -1.5958
54 L B -0.4915
55 H B -0.5949
56 S B -0.5617
57 G B -0.5463
58 V B 0.0000
59 P B -0.3339
60 S B -0.3456
61 R B -0.9342
62 F B 0.0000
63 S B -0.5785
64 G B -0.5910
65 S B -0.9207
66 G B -1.1356
67 S B -1.3547
68 G B -1.8295
69 T B -2.3256
70 D B -2.3901
71 Y B 0.0000
72 S B -0.8125
73 L B 0.0000
74 T B -0.7198
75 I B 0.0000
76 A B -1.8050
77 N B -2.3787
78 L B 0.0000
79 E B -2.1305
80 Q B -2.2939
81 E B -2.4918
82 D B 0.0000
83 I B -1.2261
84 A B 0.0000
85 T B -1.0288
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 G B 0.0000
92 D B -0.6411
93 T B -0.0908
94 L B 0.5677
95 P B -0.2388
96 F B 0.0000
97 T B -0.6641
98 F B 0.0000
99 G B 0.0000
100 S B -0.8849
101 G B 0.0000
102 T B 0.0000
103 K B -1.8417
104 L B 0.0000
105 E B -2.1016
106 I B -1.4724
107 K B -1.7652
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8668 1.4995 View CSV PDB
4.5 -0.9075 1.3886 View CSV PDB
5.0 -0.9543 1.2514 View CSV PDB
5.5 -0.9994 1.1042 View CSV PDB
6.0 -1.035 0.9587 View CSV PDB
6.5 -1.0563 0.8715 View CSV PDB
7.0 -1.0628 0.9006 View CSV PDB
7.5 -1.058 0.9478 View CSV PDB
8.0 -1.0457 1.005 View CSV PDB
8.5 -1.0273 1.0649 View CSV PDB
9.0 -1.0034 1.1217 View CSV PDB