Project name: HSA7C10_prot3D_74_015M

Status: done

Started: 2026-02-25 09:24:34
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQSYDSSLGGWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARPTETGSMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:46)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a85e1a5639298c7/tmp/folded.pdb                (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:05)
Show buried residues

Minimal score value
-2.8307
Maximal score value
1.5225
Average score
-0.5192
Total score value
-118.8902

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.6483
2 S A 0.3963
3 V A 1.4160
4 L A 0.0000
5 T A 0.0904
6 Q A 0.0000
7 P A -0.4320
8 P A -0.6436
9 S A -0.5539
11 V A -0.1382
12 S A -0.2849
13 G A 0.0000
14 A A -0.2405
15 P A -0.9500
16 G A -1.8080
17 Q A -2.3943
18 R A -2.6832
19 V A 0.0000
20 T A -0.5139
21 I A 0.0000
22 S A -0.3026
23 C A 0.0000
24 T A -0.1789
25 G A -0.0018
26 S A -0.1619
27 S A -0.6205
28 S A -0.2509
29 N A 0.0000
30 I A 0.0000
31 G A -0.8404
35 A A -0.5264
36 G A -0.7034
37 Y A -0.4473
38 D A -1.3008
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 L A -0.2265
46 P A -0.4843
47 G A -0.4002
48 T A -0.3762
49 A A -0.4341
50 P A 0.0000
51 K A -0.8542
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -0.8697
56 G A -1.1765
57 N A -1.1388
65 S A -1.2101
66 N A -1.5744
67 R A -1.9874
68 P A -1.2015
69 S A -0.7924
70 G A -0.9824
71 V A -0.8372
72 P A -1.2896
74 D A -2.1790
75 R A -1.5111
76 F A 0.0000
77 S A -0.8644
78 G A -0.6936
79 S A -0.7847
80 K A -1.0587
83 S A -0.7600
84 G A -0.8866
85 T A -0.6637
86 S A -0.6101
87 A A 0.0000
88 S A -0.3929
89 L A 0.0000
90 A A 0.0000
91 I A 0.0000
92 T A -1.8974
93 G A -1.8652
94 L A 0.0000
95 Q A -1.6596
96 A A -1.3629
97 E A -2.2897
98 D A 0.0000
99 E A -1.8138
100 A A 0.0000
101 D A -0.7914
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 S A 0.0000
107 Y A 0.0992
108 D A 0.0000
109 S A -0.1124
110 S A 0.0282
113 L A 0.3833
114 G A 0.3497
115 G A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4246
121 G A 0.0000
122 T A 0.0000
123 K A -1.0165
124 V A 0.0000
125 T A -0.4433
126 V A 0.0507
127 L A 1.2558
1 Q B -0.9379
2 V B 0.0705
3 Q B -0.4122
4 L B 0.0000
5 V B 1.1050
6 Q B 0.2547
7 S B -0.5739
8 G B -0.8836
9 G B -0.5522
11 G B 0.4431
12 V B 1.5225
13 V B 0.1356
14 Q B -1.5817
15 P B -2.2039
16 G B -2.2012
17 R B -2.8307
18 S B -1.9629
19 L B -1.2557
20 R B -2.0832
21 L B 0.0000
22 S B -0.4669
23 C B 0.0000
24 A B -0.1271
25 A B -0.0839
26 S B -0.3212
27 G B -0.3632
28 F B 0.0483
29 T B -0.3086
30 F B -0.2546
35 S B 0.1643
36 S B 0.3874
37 Y B 0.7011
38 G B 0.3710
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.6793
45 A B -0.9323
46 P B -0.9561
47 G B -1.4731
48 K B -2.1927
49 G B -1.3841
50 L B 0.0000
51 E B -0.4702
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.3594
58 Y B 0.6916
59 D B -1.1727
62 G B -0.7361
63 S B -0.7063
64 N B -0.5228
65 K B -0.5769
66 Y B 0.0053
67 Y B -0.5965
68 A B 0.0000
69 D B -2.4405
70 S B -1.8641
71 V B 0.0000
72 K B -2.4558
74 G B -1.6548
75 R B 0.0000
76 F B 0.0000
77 T B -0.7469
78 I B 0.0000
79 S B -0.7178
80 R B -1.2005
81 D B -1.6013
82 N B -1.6180
83 S B -1.5296
84 K B -2.2374
85 N B -1.4620
86 T B -0.9050
87 L B 0.0000
88 Y B -0.5376
89 L B 0.0000
90 Q B -1.1816
91 M B 0.0000
92 N B -2.1679
93 S B -1.9799
94 L B 0.0000
95 R B -2.5575
96 A B -1.4585
97 E B -1.5081
98 D B 0.0000
99 T B -0.2171
100 A B 0.0000
101 V B 0.1635
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4160
107 P B -0.5373
108 T B -0.9695
109 E B -1.6805
110 T B -0.9830
113 G B -0.7445
114 S B 0.0000
115 M B 0.0000
116 D B -0.9863
117 V B -0.4378
118 W B 0.0000
119 G B 0.0000
120 Q B -0.8486
121 G B -0.3831
122 T B 0.0000
123 T B 0.0828
124 V B 0.0000
125 T B 0.3765
126 V B -0.5865
127 S B -0.3920
128 S B -0.4889
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4758 2.1783 View CSV PDB
4.5 -0.51 2.1564 View CSV PDB
5.0 -0.5489 2.1273 View CSV PDB
5.5 -0.587 2.0958 View CSV PDB
6.0 -0.6183 2.0668 View CSV PDB
6.5 -0.638 2.0451 View CSV PDB
7.0 -0.6466 2.033 View CSV PDB
7.5 -0.6478 2.028 View CSV PDB
8.0 -0.6442 2.0262 View CSV PDB
8.5 -0.6359 2.0256 View CSV PDB
9.0 -0.6218 2.0254 View CSV PDB