Project name: A0A1

Status: done

Started: 2026-03-03 12:18:18
Chain sequence(s) A: MNKTIAVIGAGLSGIAAVKQLTDGGHQVTCFEKAESFGGVFADKKIYDDLHLTISNYFMAYSDYVPNHQKLKFWSKKEYINYLGEYIERFDIAKHIHYDHEVCCVQKQGDKWLVTYKNADTEQTKEFDMVAVCSGHFQKPKLPDLPGLDMYQGNIEHSNDYRDKHNYAGKRVLCVGLGESSADITSEISQVARKCILSLRRYPAVAPRYMAFQEDPYFTIDTSWLTSRIVNKLPHRYHGGITKGIFNKYVTSRNDHVRIRGEWLKKSGPSHHQAVTKNERLFRPIADGKVTPNIGGIERFEKNAVVFKDGTREEIDAVVFCTGYQLSFPFLDVSIANMRDLYKQMFIPEMGHSLSFIGFVRPQQGGIPVIAEMQCRYLSKLASGEAQLPTLSEMHDVIKYDTKHWQTEYKITPHVASLVNYCHYMDSVAKLVGCMPQIPSLFKDPMLRVKLLHNPQFAAQYRLDGPNNMTHTAREFLLSFPNISSWPRIIHFEVALAAQKLLSRLRLDGLREISK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations Yes
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:07:33)
[INFO]       AutoMutEv:Residue number 442 from chain A and a score of 1.663 (phenylalanine)        
                       selected for automated mutation                                             (00:07:36)
[INFO]       AutoMutEv:Residue number 441 from chain A and a score of 1.663 (leucine) selected for 
                       automated mutation                                                          (00:07:36)
[INFO]       AutoMutEv:Residue number 494 from chain A and a score of 1.405 (valine) selected for  
                       automated mutation                                                          (00:07:36)
[INFO]       AutoMutEv:Residue number 137 from chain A and a score of 1.200 (phenylalanine)        
                       selected for automated mutation                                             (00:07:36)
[INFO]       AutoMutEv:Residue number 212 from chain A and a score of 1.157 (phenylalanine)        
                       selected for automated mutation                                             (00:07:36)
[INFO]       AutoMutEv:Residue number 490 from chain A and a score of 1.039 (isoleucine) selected  
                       for automated mutation                                                      (00:07:36)
[INFO]       AutoMutEv:Mutating residue number 442 from chain A (phenylalanine) into methionine    (00:07:36)
[INFO]       AutoMutEv:Mutating residue number 442 from chain A (phenylalanine) into tyrosine      (00:07:36)
[INFO]       AutoMutEv:Mutating residue number 494 from chain A (valine) into threonine            (00:07:36)
[INFO]       AutoMutEv:Mutating residue number 494 from chain A (valine) into alanine              (00:07:48)
[INFO]       AutoMutEv:Mutating residue number 441 from chain A (leucine) into methionine          (00:07:49)
[INFO]       AutoMutEv:Mutating residue number 442 from chain A (phenylalanine) into tryptophan    (00:07:50)
[INFO]       AutoMutEv:Mutating residue number 494 from chain A (valine) into methionine           (00:08:01)
[INFO]       AutoMutEv:Mutating residue number 137 from chain A (phenylalanine) into tryptophan    (00:08:03)
[INFO]       AutoMutEv:Mutating residue number 212 from chain A (phenylalanine) into methionine    (00:08:05)
[INFO]       AutoMutEv:Mutating residue number 212 from chain A (phenylalanine) into tryptophan    (00:08:18)
[INFO]       AutoMutEv:Mutating residue number 137 from chain A (phenylalanine) into tyrosine      (00:08:19)
[INFO]       AutoMutEv:Mutating residue number 137 from chain A (phenylalanine) into methionine    (00:08:20)
[INFO]       AutoMutEv:Mutating residue number 212 from chain A (phenylalanine) into tyrosine      (00:08:38)
[INFO]       AutoMutEv:Mutating residue number 490 from chain A (isoleucine) into methionine       (00:08:38)
[INFO]       AutoMutEv:Mutating residue number 490 from chain A (isoleucine) into leucine          (00:08:59)
[INFO]       AutoMutEv:Mutating residue number 490 from chain A (isoleucine) into threonine        (00:09:02)
[INFO]       AutoMutEv:Effect of mutation residue number 442 from chain A (phenylalanine) into     
                       methionine: Energy difference: 0.0319 kcal/mol, Difference in average score 
                       from the base case: -0.0047                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 442 from chain A (phenylalanine) into     
                       tryptophan: Energy difference: 0.1272 kcal/mol, Difference in average score 
                       from the base case: -0.0055                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 442 from chain A (phenylalanine) into     
                       tyrosine: Energy difference: 0.0027 kcal/mol, Difference in average score   
                       from the base case: -0.0034                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 441 from chain A (leucine) into           
                       methionine: Energy difference: -0.6816 kcal/mol, Difference in average      
                       score from the base case: -0.0055                                           (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 494 from chain A (valine) into threonine: 
                       Energy difference: 0.1557 kcal/mol, Difference in average score from the    
                       base case: -0.0128                                                          (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 494 from chain A (valine) into alanine:   
                       Energy difference: -0.3297 kcal/mol, Difference in average score from the   
                       base case: -0.0106                                                          (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 494 from chain A (valine) into            
                       methionine: Energy difference: -0.6974 kcal/mol, Difference in average      
                       score from the base case: -0.0063                                           (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 137 from chain A (phenylalanine) into     
                       methionine: Energy difference: 0.8504 kcal/mol, Difference in average score 
                       from the base case: -0.0130                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 137 from chain A (phenylalanine) into     
                       tryptophan: Energy difference: 0.6813 kcal/mol, Difference in average score 
                       from the base case: -0.0154                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 137 from chain A (phenylalanine) into     
                       tyrosine: Energy difference: -0.0598 kcal/mol, Difference in average score  
                       from the base case: -0.0059                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 212 from chain A (phenylalanine) into     
                       methionine: Energy difference: 0.3122 kcal/mol, Difference in average score 
                       from the base case: -0.0111                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 212 from chain A (phenylalanine) into     
                       tryptophan: Energy difference: 0.8578 kcal/mol, Difference in average score 
                       from the base case: -0.0015                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 212 from chain A (phenylalanine) into     
                       tyrosine: Energy difference: 0.3224 kcal/mol, Difference in average score   
                       from the base case: 0.0000                                                  (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 490 from chain A (isoleucine) into        
                       threonine: Energy difference: 0.7164 kcal/mol, Difference in average score  
                       from the base case: -0.0072                                                 (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 490 from chain A (isoleucine) into        
                       methionine: Energy difference: -0.3915 kcal/mol, Difference in average      
                       score from the base case: -0.0068                                           (00:09:18)
[INFO]       AutoMutEv:Effect of mutation residue number 490 from chain A (isoleucine) into        
                       leucine: Energy difference: -0.1667 kcal/mol, Difference in average score   
                       from the base case: -0.0017                                                 (00:09:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:26)
Show buried residues

Minimal score value
-4.0366
Maximal score value
1.6632
Average score
-0.8262
Total score value
-425.5028

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.0463
2 N A -1.5746
3 K A -1.4931
4 T A -1.6301
5 I A 0.0000
6 A A 0.0000
7 V A 0.0000
8 I A 0.0000
9 G A -0.5215
10 A A 0.0000
11 G A 0.2196
12 L A 0.3869
13 S A 0.0000
14 G A 0.0000
15 I A 0.0000
16 A A 0.0000
17 A A 0.0000
18 V A 0.0000
19 K A -0.8097
20 Q A 0.0000
21 L A 0.0000
22 T A -1.4351
23 D A -2.0262
24 G A -1.7485
25 G A -1.6142
26 H A 0.0000
27 Q A -1.9734
28 V A 0.0000
29 T A -0.6307
30 C A 0.0000
31 F A 0.0000
32 E A 0.0000
33 K A -2.9680
34 A A -2.1833
35 E A -2.1039
36 S A -1.4007
37 F A -0.1874
38 G A 0.0000
39 G A 0.0612
40 V A 0.4001
41 F A -0.5371
42 A A 0.0000
43 D A -3.0386
44 K A -2.9848
45 K A -2.5546
46 I A -1.8947
47 Y A -2.3365
48 D A -3.4745
49 D A -2.7450
50 L A -1.5707
51 H A -1.4961
52 L A 0.0000
53 T A -0.2086
54 I A 0.0000
55 S A 0.0000
56 N A 0.0000
57 Y A 0.0000
58 F A 0.0000
59 M A 0.0000
60 A A 0.0000
61 Y A 0.0000
62 S A 0.0000
63 D A -0.2766
64 Y A -0.2828
65 V A -0.2440
66 P A 0.0000
67 N A -2.2721
68 H A -2.0770
69 Q A -2.1049
70 K A -2.4826
71 L A 0.0000
72 K A -1.1818
73 F A -0.5543
74 W A 0.0000
75 S A -1.5808
76 K A 0.0000
77 K A -2.4586
78 E A -1.6224
79 Y A 0.0000
80 I A -1.3926
81 N A -2.1881
82 Y A 0.0000
83 L A 0.0000
84 G A -2.1092
85 E A -3.4069
86 Y A 0.0000
87 I A 0.0000
88 E A -4.0366
89 R A -3.5544
90 F A -2.3947
91 D A -3.4076
92 I A 0.0000
93 A A -1.9085
94 K A -2.4425
95 H A -1.4534
96 I A 0.0000
97 H A -1.5268
98 Y A -1.6791
99 D A -3.0659
100 H A -2.7606
101 E A -2.5052
102 V A 0.0000
103 C A -0.4851
104 C A -0.0656
105 V A 0.0000
106 Q A -2.0417
107 K A -3.5360
108 Q A -3.1844
109 G A -2.5850
110 D A -3.2062
111 K A -3.4863
112 W A 0.0000
113 L A -1.8431
114 V A 0.0000
115 T A -1.1864
116 Y A 0.0000
117 K A -3.0050
118 N A -2.8189
119 A A -1.8480
120 D A -2.3992
121 T A -2.2869
122 E A -3.0054
123 Q A -2.0005
124 T A -1.5781
125 K A -2.1350
126 E A -2.8890
127 F A 0.0000
128 D A -2.2925
129 M A 0.0000
130 V A 0.0000
131 A A 0.0000
132 V A 0.0000
133 C A 0.0000
134 S A -0.0760
135 G A 0.3388
136 H A 0.4094
137 F A 1.2002
138 Q A -0.3386
139 K A -1.1558
140 P A -0.9132
141 K A -0.9436
142 L A -0.2201
143 P A -0.7185
144 D A -1.8758
145 L A -1.4323
146 P A -1.5421
147 G A -1.6954
148 L A -1.6185
149 D A -2.3114
150 M A -1.7291
151 Y A 0.0000
152 Q A -2.4981
153 G A -1.8810
154 N A -1.1044
155 I A -0.0673
156 E A -0.6725
157 H A 0.0000
158 S A -1.2935
159 N A -1.8228
160 D A -2.6976
161 Y A 0.0000
162 R A -3.3469
163 D A -2.7856
164 K A -2.1795
165 H A -2.4272
166 N A -2.4202
167 Y A 0.0000
168 A A -1.6731
169 G A -1.8501
170 K A -2.0012
171 R A -2.0264
172 V A 0.0000
173 L A 0.0000
174 C A 0.0000
175 V A 0.0000
176 G A -0.5633
177 L A 0.0000
178 G A -0.3940
179 E A -0.5557
180 S A -0.3145
181 S A 0.0000
182 A A 0.0000
183 D A 0.0000
184 I A 0.0000
185 T A 0.0000
186 S A 0.0000
187 E A -0.8619
188 I A 0.0000
189 S A 0.0000
190 Q A -1.5606
191 V A -1.3813
192 A A -2.0846
193 R A -2.7374
194 K A -2.1973
195 C A 0.0000
196 I A 0.0000
197 L A 0.0000
198 S A 0.0000
199 L A 0.0000
200 R A -2.1409
201 R A -1.4635
202 Y A -1.0500
203 P A -0.7243
204 A A 0.0000
205 V A 0.0000
206 A A 0.0000
207 P A 0.0000
208 R A 0.0250
209 Y A 0.7556
210 M A 0.6222
211 A A 0.6605
212 F A 1.1574
213 Q A -0.3739
214 E A -1.8407
215 D A -1.2079
216 P A -1.0974
217 Y A -0.7078
218 F A 0.0000
219 T A 0.0000
220 I A 0.3711
221 D A 0.0000
222 T A 0.0000
223 S A 0.0000
224 W A 0.0000
225 L A 0.2207
226 T A 0.0000
227 S A 0.0000
228 R A 0.0000
229 I A 0.0000
230 V A 0.0000
231 N A -1.2120
232 K A -1.9829
233 L A 0.0000
234 P A -1.5809
235 H A -2.3782
236 R A -2.4634
237 Y A -1.2748
238 H A -1.4949
239 G A -1.8924
240 G A -1.6001
241 I A -0.5790
242 T A -0.7616
243 K A -2.1372
244 G A -1.5007
245 I A -0.1834
246 F A -1.0865
247 N A -1.8930
248 K A -1.8870
249 Y A 0.0000
250 V A -1.4014
251 T A -1.5686
252 S A 0.0000
253 R A -3.0137
254 N A -2.7992
255 D A -2.9453
256 H A -2.2405
257 V A -1.6453
258 R A -1.8506
259 I A -0.8831
260 R A 0.0000
261 G A 0.0000
262 E A -1.8314
263 W A 0.0000
264 L A -1.3367
265 K A -2.6584
266 K A -2.8128
267 S A 0.0000
268 G A -1.2270
269 P A -1.0883
270 S A -0.4363
271 H A -0.8199
272 H A -0.9568
273 Q A 0.0000
274 A A -0.2141
275 V A 0.0270
276 T A 0.0000
277 K A 0.0000
278 N A 0.0000
279 E A -0.7587
280 R A -1.0157
281 L A 0.0000
282 F A 0.0000
283 R A -2.3571
284 P A -1.8919
285 I A -1.3813
286 A A -2.0355
287 D A -2.7901
288 G A -1.9300
289 K A -2.3285
290 V A 0.0000
291 T A -0.5641
292 P A -0.0008
293 N A 0.0000
294 I A -0.6099
295 G A -1.8053
296 G A 0.0000
297 I A -2.0622
298 E A -3.1418
299 R A -2.1374
300 F A 0.0000
301 E A -2.8319
302 K A -3.1436
303 N A -3.1106
304 A A -2.8695
305 V A 0.0000
306 V A -2.5155
307 F A 0.0000
308 K A -3.7276
309 D A -3.1810
310 G A -2.5000
311 T A -2.2378
312 R A -3.2058
313 E A -2.4046
314 E A -3.0115
315 I A 0.0000
316 D A -1.8109
317 A A 0.0000
318 V A 0.0000
319 V A 0.0000
320 F A 0.0000
321 C A 0.0000
322 T A -0.2180
323 G A -0.3082
324 Y A -0.2105
325 Q A -0.5794
326 L A -0.0340
327 S A -0.2434
328 F A 0.0000
329 P A -0.4738
330 F A 0.0000
331 L A 0.0000
332 D A -1.8864
333 V A -0.5690
334 S A -0.3802
335 I A -0.2606
336 A A -0.2935
337 N A -0.8257
338 M A 0.0000
339 R A 0.0000
340 D A -2.1241
341 L A 0.0000
342 Y A 0.0000
343 K A -0.3288
344 Q A 0.0000
345 M A 0.0000
346 F A 0.0000
347 I A -0.5340
348 P A 0.0000
349 E A -1.5313
350 M A -0.8390
351 G A -0.5917
352 H A -0.6085
353 S A -1.0600
354 L A 0.0000
355 S A 0.0000
356 F A 0.0000
357 I A 0.0000
358 G A 0.0000
359 F A 0.0000
360 V A 0.0000
361 R A -0.2900
362 P A 0.0000
363 Q A 0.0000
364 Q A -0.1913
365 G A 0.0000
366 G A 0.0000
367 I A 0.3595
368 P A 0.0000
369 V A 0.0000
370 I A 0.0000
371 A A 0.0000
372 E A 0.0000
373 M A 0.0000
374 Q A 0.0000
375 C A 0.0000
376 R A 0.0000
377 Y A 0.0000
378 L A 0.0000
379 S A -1.0725
380 K A -1.2756
381 L A 0.0000
382 A A 0.0000
383 S A -1.2620
384 G A -1.6290
385 E A -2.2854
386 A A -1.6232
387 Q A -1.6430
388 L A -0.5390
389 P A -0.5866
390 T A -0.6124
391 L A -0.3548
392 S A -1.1150
393 E A -2.2592
394 M A 0.0000
395 H A -2.0506
396 D A -2.5511
397 V A -1.5104
398 I A 0.0000
399 K A -2.6352
400 Y A -0.5475
401 D A 0.0000
402 T A -1.7927
403 K A -2.0947
404 H A -1.4612
405 W A 0.0000
406 Q A -2.0131
407 T A -1.5916
408 E A -1.4550
409 Y A 0.0000
410 K A -1.9692
411 I A -0.7707
412 T A 0.0000
413 P A -1.0814
414 H A -1.0809
415 V A -0.3622
416 A A -0.5664
417 S A -0.2503
418 L A 0.0000
419 V A 0.0000
420 N A -0.4271
421 Y A 0.0000
422 C A 0.0000
423 H A -0.7093
424 Y A 0.0000
425 M A 0.0000
426 D A -0.6274
427 S A -0.6288
428 V A 0.0000
429 A A 0.0000
430 K A -1.6233
431 L A -0.5912
432 V A 0.0000
433 G A -1.0362
434 C A 0.0000
435 M A -0.6907
436 P A 0.0000
437 Q A -0.8792
438 I A 0.1256
439 P A 0.0000
440 S A 0.5388
441 L A 1.6627
442 F A 1.6632
443 K A -0.3529
444 D A 0.0000
445 P A 0.7747
446 M A 0.7344
447 L A 0.0000
448 R A 0.2108
449 V A 0.0000
450 K A 0.0000
451 L A 0.0000
452 L A 0.0000
453 H A 0.0000
454 N A 0.0000
455 P A 0.0000
456 Q A 0.0000
457 F A 0.0000
458 A A 0.0000
459 A A 0.0000
460 Q A 0.0000
461 Y A 0.0000
462 R A 0.0000
463 L A 0.0000
464 D A -1.2744
465 G A -1.4814
466 P A -1.2768
467 N A -1.9696
468 N A -2.0279
469 M A -1.1720
470 T A -1.4917
471 H A -1.8473
472 T A -1.5234
473 A A 0.0000
474 R A -1.7258
475 E A -2.4320
476 F A 0.0000
477 L A 0.0000
478 L A -0.3232
479 S A -0.8187
480 F A 0.0000
481 P A -0.4379
482 N A -0.6067
483 I A 0.0000
484 S A 0.0000
485 S A -0.1001
486 W A 0.6152
487 P A 0.0185
488 R A -0.2757
489 I A 0.0000
490 I A 1.0389
491 H A 0.0305
492 F A 0.0000
493 E A 0.5601
494 V A 1.4051
495 A A 0.6337
496 L A 0.0042
497 A A 0.4654
498 A A 0.5372
499 Q A -0.2574
500 K A -0.9800
501 L A 0.8079
502 L A 0.9471
503 S A -0.6495
504 R A -1.1284
505 L A 0.1175
506 R A -1.3833
507 L A -0.5382
508 D A -1.3273
509 G A -1.0126
510 L A -0.4845
511 R A -2.2068
512 E A -2.2835
513 I A 0.1549
514 S A -1.1118
515 K A -2.0181
Download PDB file
View in 3Dmol

Automated mutations analysis - evolutionary conserved mutations

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated based off an evolutionary approach. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file .

Mutant
Energetic effect
Score comparison
VA494A -0.3297 -0.0106 View CSV PDB
VM494A -0.6974 -0.0063 View CSV PDB
LM441A -0.6816 -0.0055 View CSV PDB
IM490A -0.3915 -0.0068 View CSV PDB
FY137A -0.0598 -0.0059 View CSV PDB
IL490A -0.1667 -0.0017 View CSV PDB
FY442A 0.0027 -0.0034 View CSV PDB
FM442A 0.0319 -0.0047 View CSV PDB
FM212A 0.3122 -0.0111 View CSV PDB
FW137A 0.6813 -0.0154 View CSV PDB
FW212A 0.8578 -0.0015 View CSV PDB