Project name: ok 5

Status: done

Started: 2026-03-17 06:55:15
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASSSVSYMNWYKQKPGLAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:04)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:04)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:04)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:04)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:04)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:20)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:21)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:21)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/a9e9295edeba5e5/tmp/folded.pdb                (00:05:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:29)
Show buried residues

Minimal score value
-3.3749
Maximal score value
1.1433
Average score
-0.7089
Total score value
-169.4226

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7296
2 I A 0.0000
3 V A 1.0769
4 L A 0.0000
5 T A -0.2174
6 K A -0.4411
7 S A -0.4547
8 P A -0.3667
9 A A -0.4745
10 T A -0.5390
11 L A -0.5095
12 S A -0.9520
13 L A -1.2801
14 S A -1.7912
15 P A -1.9856
16 G A -2.4615
17 E A -3.0791
18 R A -3.3177
19 A A 0.0000
20 T A -0.5572
21 L A 0.0000
22 S A -0.6883
23 C A 0.0000
24 S A -0.8078
25 A A 0.0000
26 S A -0.2681
27 S A -0.5707
28 S A -0.8053
29 V A 0.0000
30 S A -0.5212
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3815
37 Q A 0.0000
38 K A -0.7762
39 P A -0.2799
40 G A -0.0842
41 L A 0.7028
42 A A 0.0575
43 P A 0.0000
44 R A -0.4088
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3450
49 D A -0.9706
50 T A -0.6272
51 S A -0.6520
52 N A -0.5517
53 L A -0.1403
54 A A 0.0000
55 T A -0.1923
56 G A -0.6644
57 I A -0.3927
58 P A -0.9421
59 D A -1.8732
60 R A -1.8600
61 F A 0.0000
62 S A -0.6944
63 G A -0.4795
64 S A -0.9371
65 G A -1.1781
66 S A -1.1038
67 G A -1.0458
68 T A -1.3142
69 D A -2.1658
70 F A 0.0000
71 T A -0.7523
72 L A 0.0000
73 T A -0.8115
74 I A 0.0000
75 S A -2.4327
76 R A -3.3749
77 L A 0.0000
78 E A -2.2903
79 P A -1.7862
80 E A -2.3431
81 D A 0.0000
82 F A 0.0000
83 A A 0.0000
84 V A -0.7400
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0957
91 S A -0.3148
92 S A -1.1252
93 N A -1.7499
94 P A -1.5814
95 F A 0.0000
96 T A 0.0000
97 F A 0.2518
98 G A 0.0000
99 Q A -1.0517
100 G A 0.0000
101 T A 0.0000
102 K A -1.2087
103 L A 0.0000
104 E A -1.5756
105 I A -1.2286
106 K A -2.0933
107 G A -1.6043
108 G A -1.4536
109 G A -1.2144
110 G A -1.4061
111 S A -1.0787
112 G A -1.5894
113 G A -1.5669
114 G A -1.5891
115 G A -1.5701
116 S A -1.0884
117 G A -1.2681
118 G A -1.2188
119 G A -1.3546
120 G A -1.4202
121 S A -1.3860
122 Q A -1.7888
123 V A 0.0000
124 Q A -1.5443
125 L A 0.0000
126 V A 0.3108
127 Q A 0.0000
128 S A -0.5511
129 G A -0.5883
130 A A -0.0317
131 E A -0.0604
132 V A 0.9617
133 Q A -0.7476
134 K A -2.0456
135 P A -2.0998
136 G A -1.4881
137 A A -1.1652
138 S A -1.2428
139 V A 0.0000
140 K A -1.8014
141 V A 0.0000
142 S A -0.5929
143 C A 0.0000
144 K A -0.9894
145 A A 0.0000
146 S A -0.8196
147 G A -0.9494
148 Y A -0.7169
149 T A -0.8049
150 F A 0.0000
151 N A -2.1899
152 R A -2.4205
153 Y A -1.2620
154 T A -0.6262
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1652
160 Q A -0.3339
161 A A -0.7195
162 P A -0.7173
163 G A -1.0387
164 Q A -1.0400
165 L A 0.0000
166 L A -0.2168
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3691
171 I A 0.0000
172 N A -0.6212
173 P A 0.0000
174 S A -1.7494
175 R A -1.5968
176 G A -0.5035
177 Y A 1.0123
178 Y A 1.1433
179 N A -0.4935
180 Y A -1.3353
181 A A -1.9558
182 Q A -2.8810
183 K A -2.8922
184 F A 0.0000
185 K A -3.2180
186 D A -2.9934
187 R A -1.9829
188 V A 0.0000
189 T A -0.8849
190 M A 0.0000
191 T A -0.2244
192 R A -1.3706
193 D A -1.2347
194 T A -0.9031
195 S A -0.5671
196 T A -0.6901
197 S A -0.9263
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7663
201 M A 0.0000
202 E A -1.3550
203 L A 0.0000
204 S A -1.1944
205 S A -1.2354
206 L A 0.0000
207 R A -2.7274
208 S A -2.2120
209 E A -2.4392
210 D A 0.0000
211 T A -0.8220
212 A A -0.3052
213 V A 0.0957
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0929
221 D A -2.4655
222 D A -2.5293
223 H A -1.4549
224 Y A -0.5234
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1293
229 W A -0.1898
230 G A 0.0000
231 Q A -0.7211
232 G A -0.2080
233 T A 0.0000
234 T A 0.0057
235 V A 0.0000
236 T A -0.2607
237 V A 0.0000
238 S A -0.8129
239 S A -0.9394
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6768 1.8432 View CSV PDB
4.5 -0.7198 1.8484 View CSV PDB
5.0 -0.7699 1.8628 View CSV PDB
5.5 -0.8188 1.8951 View CSV PDB
6.0 -0.8579 1.9489 View CSV PDB
6.5 -0.8813 2.0178 View CSV PDB
7.0 -0.8891 2.0935 View CSV PDB
7.5 -0.8863 2.1716 View CSV PDB
8.0 -0.8771 2.2502 View CSV PDB
8.5 -0.8617 2.3283 View CSV PDB
9.0 -0.8389 2.4036 View CSV PDB