Project name: ValAla_R1

Status: done

Started: 2026-08-20 09:16:23
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aa039cd5615ae6e/tmp/folded.pdb                (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)
Show buried residues

Minimal score value
-2.7082
Maximal score value
1.8832
Average score
-0.5496
Total score value
-136.3106

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6873
2 V A 0.0000
3 Q A -2.0642
4 L A 0.0000
5 Q A -1.8479
6 E A 0.0000
7 S A -0.6977
8 G A -0.3947
9 P A 0.0294
10 G A 0.3776
11 L A 0.9694
12 V A 0.0000
13 K A -1.8412
14 P A -1.3489
15 S A -1.4549
16 Q A -2.0247
17 T A -1.6766
18 L A 0.0000
19 S A -1.0351
20 L A 0.0000
21 T A -0.6378
22 V A 0.0000
23 T A -1.2419
24 V A 0.0000
25 S A -1.3817
26 G A -1.4098
27 G A -1.0824
28 S A -0.7242
29 I A 0.0000
30 S A -0.2267
31 S A -0.3169
32 G A -0.1069
33 D A -0.1178
34 Y A 0.5735
35 Y A 0.5707
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2246
41 Q A 0.0000
42 P A -0.7021
43 P A -0.7035
44 G A -1.1228
45 C A -1.2609
46 K A -2.0031
47 G A -1.1795
48 L A 0.0000
49 E A -0.8082
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1440
54 I A 0.0000
55 Y A 0.3356
56 Y A 0.3829
57 S A -0.0367
58 G A -0.2871
59 S A -0.2505
60 T A -0.2048
61 D A -0.6046
62 Y A -0.7445
63 N A -1.0102
64 P A -1.2803
65 S A -1.0603
66 L A 0.0000
67 K A -2.1384
68 S A -1.4526
69 R A -1.6798
70 V A 0.0000
71 T A -1.1207
72 M A 0.0000
73 S A -0.4084
74 V A -0.3730
75 D A -1.1753
76 T A -1.0093
77 S A -1.3280
78 K A -2.1720
79 N A -1.4406
80 Q A -1.3318
81 F A 0.0000
82 S A -0.5718
83 L A 0.0000
84 K A -1.6814
85 V A 0.0000
86 N A -1.8517
87 S A -1.5899
88 V A 0.0000
89 T A -0.6929
90 A A -0.2509
91 A A 0.0327
92 D A 0.0000
93 T A 0.2696
94 A A 0.0000
95 V A 0.1784
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.3435
104 F A 1.8832
105 G A 0.6235
106 V A 0.6121
107 G A 0.6753
108 T A 0.0000
109 F A 0.0000
110 D A -0.5088
111 Y A -0.5817
112 W A -0.8246
113 G A 0.0000
114 Q A -1.6372
115 G A -0.7675
116 T A -0.1979
117 L A 0.8270
118 V A 0.0000
119 T A 0.3550
120 V A 0.0000
121 S A -0.3801
122 S A -0.6280
123 A A -0.6257
124 A A -0.3496
125 G A -0.8332
126 G A -1.0676
127 G A -1.1188
128 G A -1.1655
129 S A -1.0086
130 G A -1.1524
131 G A -1.1721
132 G A -1.1583
133 G A -1.1675
134 S A -1.0318
135 G A -1.1901
136 G A -1.1868
137 G A -1.2098
138 G A -1.1716
139 S A -0.9852
140 D A -0.8952
141 I A -0.1080
142 V A 0.9952
143 M A 0.0000
144 T A -0.5596
145 Q A -0.6607
146 S A -0.7372
147 P A -0.3722
148 A A -0.3361
149 T A -0.3977
150 L A -0.1617
151 S A -0.3065
152 L A -0.6734
153 S A -1.0153
154 P A -1.5307
155 G A -1.8328
156 E A -2.4542
157 R A -2.7082
158 A A 0.0000
159 T A -0.6692
160 L A 0.0000
161 S A -0.8821
162 V A 0.0000
163 R A -2.3047
164 A A 0.0000
165 S A -0.8368
166 Q A -1.5745
167 S A -1.2161
168 V A 0.0000
169 S A -0.4953
170 S A -0.2956
171 Y A 0.6414
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3471
179 P A -0.9515
180 G A -0.9999
181 C A -1.1249
182 Q A -1.5976
183 A A -1.1943
184 P A 0.0000
185 R A -1.5407
186 L A -0.7116
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5358
190 D A -0.7181
191 A A 0.0000
192 S A -1.1753
193 N A -1.7796
194 R A -1.6667
195 A A -1.0430
196 T A -0.6421
197 G A -0.6567
198 I A 0.0000
199 P A -0.4367
200 A A -0.3699
201 R A -0.7025
202 F A 0.0000
203 S A -0.7396
204 G A 0.0000
205 S A -0.8506
206 G A -1.1056
207 S A -0.9386
208 G A -1.0442
209 T A -1.7213
210 D A -2.0914
211 F A 0.0000
212 T A -0.7574
213 L A 0.0000
214 T A -0.5849
215 I A 0.0000
216 S A -1.3550
217 S A -1.7458
218 L A 0.0000
219 E A -2.2721
220 P A -1.5053
221 E A -2.3452
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.5582
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1401
233 S A -0.2969
234 T A -0.4391
235 P A -0.4642
236 L A 0.0000
237 T A 0.1161
238 F A 0.2521
239 G A 0.0000
240 G A -0.7818
241 G A -0.7354
242 T A 0.0000
243 K A -0.7516
244 A A 0.0000
245 E A -0.3840
246 I A 0.7199
247 K A -0.8640
248 A A -0.3367
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5161 4.7996 View CSV PDB
4.5 -0.5377 4.763 View CSV PDB
5.0 -0.5622 4.7149 View CSV PDB
5.5 -0.5841 4.6613 View CSV PDB
6.0 -0.597 4.6057 View CSV PDB
6.5 -0.5965 4.5494 View CSV PDB
7.0 -0.5832 4.493 View CSV PDB
7.5 -0.5616 4.4369 View CSV PDB
8.0 -0.5353 4.3818 View CSV PDB
8.5 -0.5055 4.3296 View CSV PDB
9.0 -0.4723 4.2848 View CSV PDB