Project name: 105-323-4

Status: done

Started: 2026-02-24 07:16:38
Chain sequence(s) A: QVHLMESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGTNRYYVDSVKGRFTISRDNSKDTVYLQMDSLRAEDTAMYYCARDRVHWNYGEDAFDVWGRGTMVIVSS
B: EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVFYCQQHGTSPLTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aa64511c798c6cd/tmp/folded.pdb                (00:02:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:29)
Show buried residues

Minimal score value
-3.0803
Maximal score value
1.7432
Average score
-0.6822
Total score value
-157.594

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.3502
2 V A -0.7075
3 H A -1.0199
4 L A 0.0000
5 M A -0.1675
6 E A 0.0000
7 S A -0.6443
8 G A -0.8781
9 G A -0.1460
10 G A 0.6313
11 V A 1.7432
12 V A 0.0000
13 Q A -1.3267
14 P A -1.8675
15 G A -2.1951
16 R A -2.7822
17 S A -2.0952
18 L A -1.2625
19 R A -2.0150
20 L A 0.0000
21 S A -0.4000
22 C A 0.0000
23 A A -0.5357
24 A A 0.0000
25 S A -0.9553
26 G A -0.8558
27 F A -0.4903
28 T A -0.5744
29 F A 0.0000
30 S A -1.4813
31 R A -1.5473
32 Y A -0.7116
33 G A 0.0000
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 A A -1.0441
41 P A -0.8304
42 G A -1.4099
43 K A -2.2130
44 G A -1.3184
45 L A 0.0000
46 E A -0.8803
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 V A 0.0000
51 I A 0.0000
52 W A -0.7011
53 Y A -0.9486
54 D A -1.7870
55 G A -1.2665
56 T A -1.0282
57 N A -1.2653
58 R A -1.0995
59 Y A -0.3102
60 Y A -0.6691
61 V A -1.2218
62 D A -2.4862
63 S A -1.7171
64 V A 0.0000
65 K A -2.4011
66 G A -1.6852
67 R A 0.0000
68 F A 0.0000
69 T A -0.7833
70 I A 0.0000
71 S A -0.4681
72 R A -1.1625
73 D A -1.9769
74 N A -2.3092
75 S A -1.8241
76 K A -2.6850
77 D A -2.2295
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2164
81 L A 0.0000
82 Q A -1.0471
83 M A 0.0000
84 D A -2.0211
85 S A -1.8123
86 L A 0.0000
87 R A -2.4221
88 A A -1.5619
89 E A -2.1594
90 D A 0.0000
91 T A -0.3127
92 A A 0.0000
93 M A 0.1852
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 D A 0.0000
100 R A -0.6461
101 V A -0.3034
102 H A -0.3525
103 W A -0.0857
104 N A -0.5892
105 Y A 0.6454
106 G A -0.0535
107 E A -0.6255
108 D A -0.4706
109 A A 0.0000
110 F A 0.0000
111 D A -0.9644
112 V A -0.6265
113 W A -0.6135
114 G A 0.0000
115 R A -2.0690
116 G A -0.9490
117 T A 0.0000
118 M A 0.6378
119 V A 0.0000
120 I A 0.7617
121 V A 0.0000
122 S A -0.3826
123 S A -0.2298
1 E B -1.7318
2 I B 0.0000
3 V B 0.7014
4 L B 0.0000
5 T B -0.7626
6 Q B -0.8057
7 S B -0.9473
8 P B -0.6113
9 G B -0.9024
10 T B -0.7260
11 L B -0.2469
12 S B -0.2520
13 L B -0.4270
14 S B -0.8398
15 P B -1.3453
16 G B -1.9428
17 E B -2.4972
18 R B -3.0340
19 A B 0.0000
20 T B -0.6425
21 L B 0.0000
22 S B -1.1412
23 C B 0.0000
24 R B -2.6219
25 A B 0.0000
26 S B -1.0927
27 Q B -1.7834
28 S B -1.4566
29 V B 0.0000
30 S B -0.4836
31 S B -0.4398
32 S B -0.3195
33 Y B -0.0051
34 L B 0.0000
35 A B 0.0000
36 W B 0.0000
37 Y B 0.0000
38 Q B 0.0000
39 Q B 0.0000
40 K B -1.6215
41 P B -1.0756
42 G B -1.5691
43 Q B -2.2916
44 A B -1.6282
45 P B 0.0000
46 R B -1.6117
47 L B 0.0000
48 L B 0.0000
49 I B 0.0000
50 Y B -0.2697
51 G B -0.3044
52 T B 0.0000
53 S B -0.6235
54 T B -0.5977
55 R B -1.3201
56 A B -0.8377
57 T B -0.6039
58 G B -0.8784
59 I B 0.0000
60 P B -1.3487
61 D B -2.2084
62 R B -1.9248
63 F B 0.0000
64 S B -0.9100
65 G B -0.4966
66 S B -0.8088
67 G B -1.3400
68 S B -1.3302
69 G B -1.4637
70 T B -2.1192
71 D B -2.9016
72 F B 0.0000
73 T B -0.9786
74 L B 0.0000
75 T B -0.8135
76 I B 0.0000
77 S B -2.2734
78 R B -3.0803
79 L B 0.0000
80 E B -1.8425
81 P B -1.2080
82 E B -2.0522
83 D B 0.0000
84 F B -0.3388
85 A B 0.0000
86 V B -0.3617
87 F B 0.0000
88 Y B 0.0000
89 C B 0.0000
90 Q B 0.0000
91 Q B 0.0000
92 H B 0.0000
93 G B -0.3456
94 T B -0.5277
95 S B -0.3740
96 P B -0.6290
97 L B 0.0200
98 T B -0.0159
99 F B 0.1854
100 G B 0.0000
101 G B -0.8517
102 G B -0.8613
103 T B 0.0000
104 K B -1.0302
105 V B 0.0000
106 E B -0.1180
107 I B 0.8279
108 K B -0.8421
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7709 1.6583 View CSV PDB
4.5 -0.8144 1.6583 View CSV PDB
5.0 -0.8639 1.6583 View CSV PDB
5.5 -0.9129 1.6583 View CSV PDB
6.0 -0.9536 1.6583 View CSV PDB
6.5 -0.9807 1.6583 View CSV PDB
7.0 -0.9952 1.6583 View CSV PDB
7.5 -1.0011 1.6931 View CSV PDB
8.0 -0.9997 1.9666 View CSV PDB
8.5 -0.9906 2.2443 View CSV PDB
9.0 -0.9741 2.5205 View CSV PDB