Project name: ok 3

Status: done

Started: 2026-03-17 06:54:21
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYKQKPGLAPRLLIYDTSNLAYGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQGLWMGYINPSRGYTNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:00)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:09)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aa6808dcf52e5e1/tmp/folded.pdb                (00:03:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:34)
Show buried residues

Minimal score value
-3.6096
Maximal score value
1.1175
Average score
-0.7615
Total score value
-182.0089

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8449
2 I A 0.0000
3 V A 0.8624
4 L A 0.0000
5 T A -0.2301
6 Q A 0.0000
7 S A -0.4471
8 P A -0.2915
9 A A -0.4293
10 T A -0.6022
11 L A -0.4611
12 S A -0.9211
13 L A -1.0324
14 S A -1.5183
15 P A -1.9496
16 G A -2.3293
17 E A -2.7434
18 R A -3.1732
19 A A 0.0000
20 T A -0.5325
21 L A 0.0000
22 S A -0.6965
23 C A 0.0000
24 R A -1.4601
25 A A 0.0000
26 S A -0.8718
27 Q A -1.6635
28 S A -1.3748
29 V A 0.0000
30 S A -0.5210
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3912
37 Q A 0.0000
38 K A -0.8827
39 P A -0.4732
40 G A -0.5032
41 L A -0.1763
42 A A -0.3322
43 P A 0.0000
44 R A -0.5114
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3149
49 D A -1.0685
50 T A -0.8427
51 S A -0.8712
52 N A -0.8514
53 L A -0.0866
54 A A 0.0000
55 Y A 1.1175
56 G A -0.0747
57 I A -0.0665
58 P A -0.7725
59 D A -1.8853
60 R A -1.9009
61 F A 0.0000
62 S A -0.7592
63 G A 0.0000
64 S A -0.9646
65 G A -1.2137
66 S A -1.1520
67 G A -1.2886
68 T A -1.7818
69 D A -2.4921
70 F A 0.0000
71 T A -0.7772
72 L A 0.0000
73 T A -0.7933
74 I A 0.0000
75 S A -2.3663
76 R A -3.3279
77 L A 0.0000
78 E A -2.6275
79 P A -1.7856
80 E A -2.6229
81 D A 0.0000
82 F A -1.0308
83 A A 0.0000
84 V A -0.5783
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0603
91 S A -0.2980
92 S A -1.2231
93 N A -1.7185
94 P A -1.5345
95 F A 0.0000
96 T A 0.0000
97 F A 0.2142
98 G A 0.0000
99 Q A -1.0873
100 G A 0.0000
101 T A 0.0000
102 K A -1.2953
103 L A 0.0000
104 E A -1.3714
105 I A -0.8041
106 K A -1.8758
107 G A -1.5044
108 G A -1.3575
109 G A -1.1727
110 G A -1.2938
111 S A -1.0559
112 G A -1.4939
113 G A -1.5637
114 G A -1.5287
115 G A -1.6269
116 S A -1.2197
117 G A -1.4791
118 G A -1.2240
119 G A -1.1747
120 G A -1.4773
121 S A -1.2349
122 Q A -1.8048
123 V A 0.0000
124 Q A -1.5691
125 L A 0.0000
126 V A 0.1670
127 Q A 0.0000
128 S A -0.5795
129 G A -0.5953
130 A A -0.0103
131 E A -0.0839
132 V A 0.9391
133 Q A -0.9150
134 K A -2.1728
135 P A -2.2813
136 G A -1.6070
137 A A -1.2785
138 S A -1.4001
139 V A 0.0000
140 K A -2.0632
141 V A 0.0000
142 S A -0.6163
143 C A 0.0000
144 K A -0.9149
145 A A 0.0000
146 S A -0.8586
147 G A -0.9589
148 Y A -0.6976
149 T A -0.7635
150 F A 0.0000
151 N A -2.1304
152 R A -2.3444
153 Y A -1.2005
154 T A -0.7615
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.4735
161 A A -0.8614
162 P A -0.9121
163 G A -1.4732
164 Q A -1.6948
165 G A -0.7790
166 L A -0.3988
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.0124
171 I A 0.0000
172 N A -0.9659
173 P A 0.0000
174 S A -1.6709
175 R A -1.7122
176 G A -0.8667
177 Y A 0.3403
178 T A -0.1396
179 N A -1.0680
180 Y A -1.6631
181 A A -2.0108
182 Q A -2.9898
183 K A -3.0025
184 F A 0.0000
185 K A -3.6096
186 D A -3.2004
187 R A -2.1565
188 V A 0.0000
189 T A -1.1341
190 M A 0.0000
191 T A -0.3996
192 R A -1.2173
193 D A -1.1654
194 T A -0.8647
195 S A -0.5684
196 T A -0.6857
197 S A -0.8830
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7241
201 M A 0.0000
202 E A -1.4950
203 L A 0.0000
204 S A -1.3101
205 S A -1.3902
206 L A 0.0000
207 R A -3.1485
208 S A -2.4304
209 E A -2.5589
210 D A 0.0000
211 T A -0.8983
212 A A 0.0000
213 V A 0.1332
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0239
221 D A -2.3637
222 D A -2.4355
223 H A -1.3016
224 Y A -0.3184
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1974
229 W A -0.1811
230 G A 0.0000
231 Q A -0.9414
232 G A -0.3466
233 T A 0.0000
234 T A 0.0450
235 V A 0.0000
236 T A -0.3350
237 V A 0.0000
238 S A -0.8844
239 S A -1.0447
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7152 1.8518 View CSV PDB
4.5 -0.7599 1.8543 View CSV PDB
5.0 -0.8117 1.8611 View CSV PDB
5.5 -0.8619 1.8767 View CSV PDB
6.0 -0.9017 1.9034 View CSV PDB
6.5 -0.9247 1.9381 View CSV PDB
7.0 -0.9312 1.9766 View CSV PDB
7.5 -0.9266 2.0164 View CSV PDB
8.0 -0.9153 2.0566 View CSV PDB
8.5 -0.8978 2.0965 View CSV PDB
9.0 -0.8729 2.1351 View CSV PDB